Close

UTS2R Membrane Protein Introduction

Introduction of UTS2R

UTS2R, a rhodopsin family G protein coupled-receptor, is encoded by UTS2R gene. It can be expressed in many tissues, such as brain, peripheral tissues, and blood vessels. Many studies conducted on UTS2R show that it has two endogenous agonists, one is urotensin II, and the other is urotensin II-related peptide. It can active the hypothalamic paraventricular neurons (PVN) which leads to increased plasma levels of adrenocorticotropic hormones. Meanwhile, researches during the past few decades suggest it is associated with various diseases, which provides possibilities for therapeutic applications.

Basic Information of UTS2R
Protein Name Urotensin-2 receptor
Gene Name UTS2R
Aliases GPR14
Organism Homo sapiens (Human)
UniProt ID Q9UKP6
Transmembrane Times 7
Length (aa) 389
Sequence MALTPESPSSFPGLAATGSSVPEPPGGPNATLNSSWASPTEPSSLEDLVATGTIGTLLSAMGVV
GVVGNAYTLVVTCRSLRAVASMYVYVVNLALADLLYLLSIPFIVATYVTKEWHFGDVGCRVLFG
LDFLTMHASIFTLTVMSSERYAAVLRPLDTVQRPKGYRKLLALGTWLLALLLTLPVMLAMRLVR
RGPKSLCLPAWGPRAHRAYLTLLFATSIAGPGLLIGLLYARLARAYRRSQRASFKRARRPGARA
LRLVLGIVLLFWACFLPFWLWQLLAQYHQAPLAPRTARIVNYLTTCLTYGNSCANPFLYTLLTR
NYRDHLRGRVRGPGSGGGRGPVPSLQPRARFQRCSGRSLSSCSPQPTDSLVLAPAAPARPAPEG
PRAPA

Function of UTS2R Membrane Protein

Urotensin II and Urotensin-II receptors are important molecular factors that regulate vasoconstriction and all the diseases that are linked to the abnormalities in blood pressure regulation (i.e., hypertension, kidney diseases, cirrhosis). Recently, Urotensin II and its receptor have also been involved in metabolic syndrome, diabetes, and schizophrenia. Recent strong findings suggest that Urotensin II and its receptor are involved in the onset and development of different epithelial cancers. Indeed, it is reported that cell growth, motility, and invasion in human breast, bladder, prostate, colorectal and glioblastoma cancer cells are regulated by Urotensin II and Urotensin-II receptor axis, which also regulates focal adhesion kinase and small Guanosine-5'-triphosphate binding proteins that likely have a role in motility and invasion mediated by Urotensin-II receptor.

UTS2R Membrane Protein IntroductionFig.1 Schematic representation of the structure of human UT. (Hélène, 2017)

Application of UTS2R Membrane Protein in Literature

  1. Yigit M., et al. Oxidative/antioxidative status, lymphocyte DNA damage, and urotensin-2 receptor level in patients with migraine attacks. Neuropsychiatr Dis Treat. 2018, 14, 367-374. PubMed ID: 29416338

    This article conducts a study in patients with migraine attacks, trying to analyze the level of oxidative/antioxidative status, lymphocyte DNA damage, and urotensin-2 receptor. These results show that the higher level is found in patients with a migraine compared to controls.

  2. Bandholtz S., et al. Urolinin: The first linear peptidic urotensin-II receptor agonist. J Med Chem. 2018, 59(22), 10100-10112. PubMed ID: 27791374

    This article reveals that individual U-II amino acid positions and side chain characteristics play an important role in U-IIR activation, which helps to identify the first peptidic Urotensin-II Receptor Agonist.

  3. Federico A., et al. Urotensin-II receptor: A double identity receptor involved in vasoconstriction and in the development of digestive tract cancers and other tumors. Cancer Drug Targets. 2017, 17(2), 109-121. PubMed ID: 27338741

    Authors in this group analyze the expression level and pathway of Urotensin II and its receptor in different kinds of cancers. These results indicate that its expression on tumor tissues is strongly associated with clinical therapy and disease diagnosis.

  4. Lim C.J., et al. Benzo[b]thiophene-2-carboxamide derivatives as potent urotensin-II receptor antagonists. Bioorg Med Chem Lett. 2016, 26(19), 4684-4686. PubMed ID: 27597245

    Authors in this article synthesize and evaluate a series of benzo[b]thiophene-2-carboxamide derivatives, and trying to find whether they can be potent urotensin-II receptor antagonists.

  5. Cadirci E., et al. Blocking of urotensin receptors as new target for treatment of carrageenan induced inflammation in rats. Peptides. 2016, 82, 35-43. PubMed ID: 27208703

    This article conducts a study in rats which have acute inflammation induced by carrageenan, to identify whether blocking of urotensin receptors can be used to treat this disease in rats. This study shows the role of urotensin II receptors in the physiopathogenesis of acute inflammatory response that underlying many diseases accompanied by inflammation.

UTS2R Preparation Options

To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-UTS2R antibody development services.


As a forward-looking research institute as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.

Reference

  1. Hélène Castel, et al. (2017) The G protein-coupled receptor UT of the neuropeptide urotensin II displays structural and functional chemokine features. Front Endocrinol (Lausanne). 8, 76.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us