Introduction of UTS2R
UTS2R, a rhodopsin family G protein coupled-receptor, is encoded by UTS2R gene. It can be expressed in many tissues, such as brain, peripheral tissues, and blood vessels. Many studies conducted on UTS2R show that it has two endogenous agonists, one is urotensin II, and the other is urotensin II-related peptide. It can active the hypothalamic paraventricular neurons (PVN) which leads to increased plasma levels of adrenocorticotropic hormones. Meanwhile, researches during the past few decades suggest it is associated with various diseases, which provides possibilities for therapeutic applications.
| Basic Information of UTS2R | |
| Protein Name | Urotensin-2 receptor |
| Gene Name | UTS2R |
| Aliases | GPR14 |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q9UKP6 |
| Transmembrane Times | 7 |
| Length (aa) | 389 |
| Sequence |
MALTPESPSSFPGLAATGSSVPEPPGGPNATLNSSWASPTEPSSLEDLVATGTIGTLLSAMGVV GVVGNAYTLVVTCRSLRAVASMYVYVVNLALADLLYLLSIPFIVATYVTKEWHFGDVGCRVLFG LDFLTMHASIFTLTVMSSERYAAVLRPLDTVQRPKGYRKLLALGTWLLALLLTLPVMLAMRLVR RGPKSLCLPAWGPRAHRAYLTLLFATSIAGPGLLIGLLYARLARAYRRSQRASFKRARRPGARA LRLVLGIVLLFWACFLPFWLWQLLAQYHQAPLAPRTARIVNYLTTCLTYGNSCANPFLYTLLTR NYRDHLRGRVRGPGSGGGRGPVPSLQPRARFQRCSGRSLSSCSPQPTDSLVLAPAAPARPAPEG PRAPA |
Function of UTS2R Membrane Protein
Urotensin II and Urotensin-II receptors are important molecular factors that regulate vasoconstriction and all the diseases that are linked to the abnormalities in blood pressure regulation (i.e., hypertension, kidney diseases, cirrhosis). Recently, Urotensin II and its receptor have also been involved in metabolic syndrome, diabetes, and schizophrenia. Recent strong findings suggest that Urotensin II and its receptor are involved in the onset and development of different epithelial cancers. Indeed, it is reported that cell growth, motility, and invasion in human breast, bladder, prostate, colorectal and glioblastoma cancer cells are regulated by Urotensin II and Urotensin-II receptor axis, which also regulates focal adhesion kinase and small Guanosine-5'-triphosphate binding proteins that likely have a role in motility and invasion mediated by Urotensin-II receptor.
Fig.1 Schematic representation of the structure of human UT. (Hélène, 2017)
Application of UTS2R Membrane Protein in Literature
This article conducts a study in patients with migraine attacks, trying to analyze the level of oxidative/antioxidative status, lymphocyte DNA damage, and urotensin-2 receptor. These results show that the higher level is found in patients with a migraine compared to controls.
This article reveals that individual U-II amino acid positions and side chain characteristics play an important role in U-IIR activation, which helps to identify the first peptidic Urotensin-II Receptor Agonist.
Authors in this group analyze the expression level and pathway of Urotensin II and its receptor in different kinds of cancers. These results indicate that its expression on tumor tissues is strongly associated with clinical therapy and disease diagnosis.
Authors in this article synthesize and evaluate a series of benzo[b]thiophene-2-carboxamide derivatives, and trying to find whether they can be potent urotensin-II receptor antagonists.
This article conducts a study in rats which have acute inflammation induced by carrageenan, to identify whether blocking of urotensin receptors can be used to treat this disease in rats. This study shows the role of urotensin II receptors in the physiopathogenesis of acute inflammatory response that underlying many diseases accompanied by inflammation.
UTS2R Preparation Options
To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-UTS2R antibody development services.
As a forward-looking research institute as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.