Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of ADGRA2
ADGRA2, also known as adhesion G protein-coupled receptor A2 or tumor endothelial marker 5, is a protein that encoded by the human GPR124 gene. Together with two other members of the GPCR protein family, Adgra1 (Gpr123) and Adgra3 (Gpr125), the three genes form a special group of adhesion G protein-coupled receptors A. It has been reported that the extracellular part of Adgra2 contains a leucine-rich repeat (LRR), an immunoglobulin domain (IG), a hormone receptor domain and a G protein-coupled receptor proteolytic site (GPS). And the intracellular part is characterized by a PDZ binding domain.
| Basic Information of ADGRA2 | |
| Protein Name | Adhesion G protein-coupled receptor A2 |
| Gene Name | ADGRA2 |
| Aliases | G-protein coupled receptor 124, Tumor endothelial marker 5 |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q96PE1 |
| Transmembrane Times | 7 |
| Length (aa) | 1338 |
| Sequence |
MGAGGRRMRGAPARLLLPLLPWLLLLLAPEARGAPGCPLSIRSCKCSGERPKGLSGGVPGPARRRVVCSG GDLPEPPEPGLLPNGTVTLLLSNNKITGLRNGSFLGLSLLEKLDLRNNIISTVQPGAFLGLGELKRLDLS NNRIGCLTSETFQGLPRLLRLNISGNIFSSLQPGVFDELPALKVVDLGTEFLTCDCHLRWLLPWAQNRSL QLSEHTLCAYPSALHAQALGSLQEAQLCCEGALELHTHHLIPSLRQVVFQGDRLPFQCSASYLGNDTRIR WYHNRAPVEGDEQAGILLAESLIHDCTFITSELTLSHIGVWASGEWECTVSMAQGNASKKVEIVVLETSA SYCPAERVANNRGDFRWPRTLAGITAYQSCLQYPFTSVPLGGGAPGTRASRRCDRAGRWEPGDYSHCLYT NDITRVLYTFVLMPINASNALTLAHQLRVYTAEAASFSDMMDVVYVAQMIQKFLGYVDQIKELVEVMVDM ASNLMLVDEHLLWLAQREDKACSRIVGALERIGGAALSPHAQHISVNARNVALEAYLIKPHSYVGLTCTA FQRREGGVPGTRPGSPGQNPPPEPEPPADQQLRFRCTTGRPNVSLSSFHIKNSVALASIQLPPSLFSSLP AALAPPVPPDCTLQLLVFRNGRLFHSHSNTSRPGAAGPGKRRGVATPVIFAGTSGCGVGNLTEPVAVSLR HWAEGAEPVAAWWSQEGPGEAGGWTSEGCQLRSSQPNVSALHCQHLGNVAVLMELSAFPREVGGAGAGLH PVVYPCTALLLLCLFATIITYILNHSSIRVSRKGWHMLLNLCFHIAMTSAVFAGGITLTNYQMVCQAVGI TLHYSSLSTLLWMGVKARVLHKELTWRAPPPQEGDPALPTPSPMLRFYLIAGGIPLIICGITAAVNIHNY RDHSPYCWLVWRPSLGAFYIPVALILLITWIYFLCAGLRLRGPLAQNPKAGNSRASLEAGEELRGSTRLR GSGPLLSDSGSLLATGSARVGTPGPPEDGDSLYSPGVQLGALVTTHFLYLAMWACGALAVSQRWLPRVVC SCLYGVAASALGLFVFTHHCARRRDVRASWRACCPPASPAAPHAPPRALPAAAEDGSPVFGEGPPSLKSS PSGSSGHPLALGPCKLTNLQLAQSQVCEAGAAAGGEGEPEPAGTRGNLAHRHPNNVHHGRRAHKSRAKGH RAGEACGKNRLKALRGGAAGALELLSSESGSLHNSPTDSYLGSSRNSPGAGLQLEGEPMLTPSEGSDTSA APLSEAGRAGQRRSASRDSLKGGGALEKESHRRSYPLNAASLNGAPKGGKYDDVTLMGAEVASGGCMKTG LWKSETTV |
Function of ADGRA2 Membrane Protein
As a member of the G protein-coupled receptor family which are characterized by seven 7 transmembrane helices, ADGRA2 receives signals from various extracellular ligands such as photons, hormones, and small molecules and translate them into several intracellular signaling cascades. The expression of ADGRA2 has been found in several human tissues, especially in the blood vessels of tumors. Studies have suggested that there is a correlation between ADGRA2 and the development of hypertension as ADGRA2 is associated with Vascular Endothelial Growth Factor (VEGF)-dependent and independent cell migration events. It has been reported that GPR124 is essential for numerous biological processes, including invasion and migration of blood vessels into neuroepithelium, establishment of BBB properties, and expansion of the cerebral cortex. Moreover, ADGRA2 is also an important regulator of neurovasculature development and a potential drug target for cerebrovascular diseases.
Fig.1 The human adhesion GPCR family.
Application of ADGRA2 Membrane Protein in Literature
1. Seigfried FA, et.al. Expression of the adhesion G protein-coupled receptor A2 (adgra2) during Xenopus laevis development. Gene Expression Patterns. 2018, 28: 54-61. PubMed ID: 29462671
This article proves that the role of ADGRA2 in embryogenesis which indicates a good starting point for further functional studies during early vertebrate development.
2. Hernández-Vásquez MN, et.al. Cell adhesion controlled by adhesion G protein-coupled receptor GPR124/ADGRA2 is mediated by a protein complex comprising intersectins and Elmo-Dock. Journal of Biological Chemistry. 2017, 292(29): 12178-91. PubMed ID: 28600358
This article reveals that ADGRA2 could promote cell adhesion through Elmo-Dock and ITSN which constitutes a previously unrecognized complex involved in ADGRA2-dependent angiogenic responses.
3. Calderón-Zamora L, et.al. Possible involvement of orphan receptors GPR88 and GPR124 in the development of hypertension in spontaneously hypertensive rat. Clinical and Experimental Hypertension. 2017, 39(6): 513-9. PubMed ID: 28678544
This report finds that the expression of ADGRA2 in rat tissues is dependent on the age and development of hypertension which indicates that ADGRA2 receptor may be involved in the development or maintenance of high blood pressure.
4. Bostaille N, et.al. Molecular insights into Adgra2/Gpr124 and Reck intracellular trafficking. Biology open. 2016, 5(12): 1874-81. PubMed ID: 27979830
This article evaluates the manner of the ADGRA2 trafficking appearance by using CRISPR/Cas9 engineered cells. It indicates that ADGRA2 trafficking occurs in a Reck-independent manner and Reck reaches the plasma membrane regardless of ADGRA2 expression and location.
ADGRA2 Preparation Options
To obtain both the soluble and functional target protein, we provide robust reconstitution forms as well as multiple active formats for membrane proteins. Based on our cutting-edge versatile Magic™ membrane protein production platform, we are capable of offering numerous approaches to our worldwide clients. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-ADGRA2 antibody development services.
With years of experience in the field of membrane protein preparation, Creative Biolabs has successfully developed a series of advanced platforms. Thus, we can provide high-quality membrane protein preparation service for worldwide customers. Our experienced scientists will do their best to help you find an ideal method for your particular project. For more detailed information, please feel free to contact us.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
