Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of ADGRB1
ADGRB1, also known as adhesion G protein-coupled receptor B1 or brain-specific angiogenesis inhibitor 1 (BAI1), is a protein encoded by the human BAI1 gene. It belongs to the adhesion G protein-coupled receptors family which comprises a group of 33 seven-transmembrane-spanning (7TM) proteins that form the second largest family of GPCRs in human. Studies have shown that ADGRB1 is characterized by the presence of large N-terminal extracellular domains (ECDs) which contain multiple subdomains.
| Basic Information of ADGRB1 | |
| Protein Name | Adhesion G protein-coupled receptor B1 |
| Gene Name | ADGRB1 |
| Aliases | Brain-specific angiogenesis inhibitor 1 |
| Organism | Homo sapiens (Human) |
| UniProt ID | O14514 |
| Transmembrane Times | 7 |
| Length (aa) | 1584 |
| Sequence |
MRGQAAAPGPVWILAPLLLLLLLLGRRARAAAGADAGPGPEPCATLVQGKFFGYFSAAAVFPANASRCSW TLRNPDPRRYTLYMKVAKAPVPCSGPGRVRTYQFDSFLESTRTYLGVESFDEVLRLCDPSAPLAFLQASK QFLQMRRQQPPQHDGLRPRAGPPGPTDDFSVEYLVVGNRNPSRAACQMLCRWLDACLAGSRSSHPCGIMQ TPCACLGGEAGGPAAGPLAPRGDVCLRDAVAGGPENCLTSLTQDRGGHGATGGWKLWSLWGECTRDCGGG LQTRTRTCLPAPGVEGGGCEGVLEEGRQCNREACGPAGRTSSRSQSLRSTDARRREELGDELQQFGFPAP QTGDPAAEEWSPWSVCSSTCGEGWQTRTRFCVSSSYSTQCSGPLREQRLCNNSAVCPVHGAWDEWSPWSL CSSTCGRGFRDRTRTCRPPQFGGNPCEGPEKQTKFCNIALCPGRAVDGNWNEWSSWSACSASCSQGRQQR TRECNGPSYGGAECQGHWVETRDCFLQQCPVDGKWQAWASWGSCSVTCGAGSQRRERVCSGPFFGGAACQ GPQDEYRQCGTQRCPEPHEICDEDNFGAVIWKETPAGEVAAVRCPRNATGLILRRCELDEEGIAYWEPPT YIRCVSIDYRNIQMMTREHLAKAQRGLPGEGVSEVIQTLVEISQDGTSYSGDLLSTIDVLRNMTEIFRRA YYSPTPGDVQNFVQILSNLLAEENRDKWEEAQLAGPNAKELFRLVEDFVDVIGFRMKDLRDAYQVTDNLV LSIHKLPASGATDISFPMKGWRATGDWAKVPEDRVTVSKSVFSTGLTEADEASVFVVGTVLYRNLGSFLA LQRNTTVLNSKVISVTVKPPPRSLRTPLEIEFAHMYNGTTNQTCILWDETDVPSSSAPPQLGPWSWRGCR TVPLDALRTRCLCDRLSTFAILAQLSADANMEKATLPSVTLIVGCGVSSLTLLMLVIIYVSVWRYIRSER SVILINFCLSIISSNALILIGQTQTRNKVVCTLVAAFLHFFFLSSFCWVLTEAWQSYMAVTGHLRNRLIR KRFLCLGWGLPALVVAISVGFTKAKGYSTMNYCWLSLEGGLLYAFVGPAAAVVLVNMVIGILVFNKLVSK DGITDKKLKERAGASLWSSCVVLPLLALTWMSAVLAVTDRRSALFQILFAVFDSLEGFVIVMVHCILRRE VQDAVKCRVVDRQEEGNGDSGGSFQNGHAQLMTDFEKDVDLACRSVLNKDIAACRTATITGTLKRPSLPE EEKLKLAHAKGPPTNFNSLPANVSKLHLHGSPRYPGGPLPDFPNHSLTLKRDKAPKSSFVGDGDIFKKLD SELSRAQEKALDTSYVILPTATATLRPKPKEEPKYSIHIDQMPQTRLIHLSTAPEASLPARSPPSRQPPS GGPPEAPPAQPPPPPPPPPPPPQQPLPPPPNLEPAPPSLGDPGEPAAHPGPSTGPSTKNENVATLSVSSL ERRKSRYAELDFEKIMHTRKRHQDMFQDLNRKLQHAAEKDKEVLGPDSKPEKQQTPNKRPWESLRKAHGT PTWVKKELEPLQPSPLELRSVEWERSGATIPLVGQDIIDLQTEV |
Function of ADGRB1 Membrane Protein
During the past years, studies have shown that the expression of ADGRB1 is rich in neurons, astrocytes, and macrophages. And low level of ADGRB1 has also been found in other tissues. It has been reported that the aGPCRs are widely distributed and critical for many physiological processes, including cell adhesion, neural development, angiogenesis, and immune system function. As a member of the aGPCRs, ADGRB1 could act as a receptor of great physiological interest for it plays a critical role in regulating macrophage phagocytosis, muscle development and synaptic plasticity in the brain. And the anti-angiogenic and anti-tumorigenic properties of ADGRB1 have also been widely studied. Recently, ADGRB1 is considered as a phagocytic receptor which has the ability to recognize phosphatidylserine exposed on apoptotic cells. What’s more, ADGRB1 has been shown to function upstream of the signaling module comprised of ELMO/Dock180/Rac proteins, thereby facilitating the cytoskeletal reorganization necessary to mediate the phagocytic clearance of apoptotic cells.
Fig.1 Multiple functions of BAI1. (Zhu, et.al. 2016)
Application of ADGRB1 Membrane Protein in Literature
1. Mathema VB, Na-Bangchang K. Regulatory roles of brain-specific angiogenesis inhibitor 1 (BAI1) protein in inflammation, tumorigenesis and phagocytosis: A brief review. Critical reviews in oncology/hematology. 2017, 111: 81-6. PubMed ID: 28259299
This article provides a comprehensive knowledge of the latest research of BAI1 for possible biomedical therapeutics.
2. Bolyard C, et.al. BAI1 Orchestrates Macrophage Inflammatory Response to HSV Infection-Implications for Oncolytic Viral Therapy. Clinical Cancer Research. 2017, 23(7): 1809-19. PubMed ID: 27852701
This article reveals that BAI has a new role in facilitating macrophage anti-viral responses. And, arming oHSV with antiangiogenic Vstat120 also shields them from inflammatory macrophage antiviral response, without reducing safety.
3. Kishore A, et.al. Stalk-dependent and stalk-independent signaling by the adhesion G protein-coupled receptors GPR56 (ADGRG1) and BAI1 (ADGRB1). Journal of Biological Chemistry. 2016, 291(7): 3385-94. PubMed ID: 26710850
This article reveals that the activation of certain pathways downstream of aGPCRs is stalk-dependent, whereas signaling to other pathways is stalk-independent.
4. Billings EA, et.al. The adhesion GPCR BAI1 mediates macrophage ROS production and microbicidal activity against Gram-negative bacteria. Sci. Signal. 2016, 9(413): ra14. PubMed ID: 26838550
This article suggests that BAI1 could mediate the clearance of Gram-negative bacteria by stimulating both phagocytosis and NADPH oxidase activation, thereby coupling bacterial detection to the cellular microbicidal machinery.
5. Chao A, et.al. BAI1-associated protein 2-like 1 (BAIAP2L1) is a potential biomarker in ovarian cancer. PloS one. 2015, 10(7): e0133081. PubMed ID: 26222696
This article suggests that BAIAP2L1 can be used as a biomarker for human ovarian cancer. And the role of BAIAP2L1 in context of the insulin receptor signaling pathways of cancer cells is warranted for developing cancer therapeutics by targeting cancer-specific metabolism.
ADGRB1 Preparation Options
With versatile Magic™ membrane protein production platform, we are capable of providing high-quality and cost-effective membrane protein preparation services for worldwide customers. Our experienced staffs will help you to find a better match for your particular project no matter in reconstitution forms or multiple active formats. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-ADGRB1 antibody development services.
Creative Biolabs now provides one-stop, custom-oriented membrane protein preparation service for global clients. Based on years of experience, we guarantee all the service will be presented in the most high-quality and cost-effective way. Please feel free to contact us for more information.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
