ADGRE4P Membrane Protein Introduction

Introduction of ADGRE4P

ADGRE4P, also known as EGF-like module receptor 4 (EMR4) or G-protein coupled receptor 127 (GPR127), is a 7 transmembrane (7TM) receptor belonging to the secretin receptor family, which is also known as family B or 2 of the G-protein-coupled receptors (GPCRs). It has been reported that human EMR4 contains a one nucleotide deletion in exon 8 that results in termination of the translation product ahead of the TM7 region. AGRE4 may be cleaved into 2 subunits, an extracellular alpha subunit, and a 7TM beta subunit.

Basic Information of ADGRE4P
Protein Name	Adhesion G protein-coupled receptor E4P
Gene Name	ADGRE4P
Aliases	EGF-like module receptor 4, EGF-like module-containing mucin-like hormone receptor-like 4, G-protein coupled receptor 127, G-protein coupled receptor PGR16
Organism	Homo sapiens (Human)
UniProt ID	Q86SQ3
Transmembrane Times	7
Length (aa)	457
Sequence	MGSRFLLVLLSGASCPPCPKYASCHNSTHCTCEDGFRARSGRTYFHDSSEKCEDINECETGLAKCKYKAY CRNKVGGYICSCLVKYTLFNFLAGIIDYDHPDCYENNSQGTTQSNVDIWVSGVKPGFGKQLPGDKRTKHI CVYWEGSEGGWSTEGCSHVHSNGSYTKCKCFHLSSFAVLVALAPKEDPVLTVITQVGLTISLLCLFLAIL TFLLCRPIQNTSTSLHLELSLCLFLAHLLFLTGINRTEPEVLCSIIAGLLHFLYLACFTWMLLEGLHLFL TVRNLKVANYTSTGRFKKRFMYPVGYGIPAVIIAVSAIVGPQNYGTFTCWLKLDKGFIWSFMGPVAVIIL INLVFYFQVLWILRSKLSSLNKEVSTIQDTRVMTFKAISQLFILGCSWGLGFFMVEEVGKTIGSIIAYSF TIINTLQGVLLFVVHCLLNRQVRLIILSVISLVPKSN

Function of ADGRE4P Membrane Protein

ADGRE4 is a member of the EGF-TM7 family which consists of a group of class B seven-span transmembrane (TM7) receptors predominantly expressed by cells of the immune system. In the past years, ADGRE4P has been widely studied. It has been reported that ADGRE4P had changed during most recent evolution. Human EMR4 contains a one nucleotide deletion in exon 8 that results in termination of the translation product ahead of the TM7 region. However, the frameshift mutation is not present in nonhuman primates, including chimpanzees, suggesting that EMR4 became nonfunctional only after human speciation. As to the expression of ADGRE4P, studies have suggested that mouse ADGRE4P is expressed on monocytes, macrophages, and CD8 myeloid dendritic cells. And expression is restricted to a subpopulation of these cell types and declines after cellular activation. What’s more, ADGRE4P may also mediate the cellular interaction between myeloid cells and B-cells during immune and inflammatory responses.

Fig.1 Depiction of 7 transmembrane (7TM) receptor.

Application of ADGRE4P Membrane Protein in Literature

1. Hamann J., et.al. Inactivation of the EGF-TM7 receptor EMR4 after the Pan-Homo divergence. European journal of immunology. 2003, 33(5): 1365-71. PubMed ID: 12731063

This article reports that translation of human EMR4, a novel human EGF-TM7 receptor, would result in a truncated 232-amino acid protein lacking the entire seven-span transmembrane region which is not present in nonhuman primates. It indicates that EMR4 surprisingly accounts for a genetic difference between humans and primates related to immunity.

2. Stacey M., et.al. EMR4, a novel epidermal growth factor (EGF)-TM7 molecule up-regulated in activated mouse macrophages, binds to a putative cellular ligand on B lymphoma cell line A20. Journal of Biological Chemistry. 2002, 277(32): 29283-93. PubMed ID: 12023293

This article finds that the mEMR4-ligand interaction is Ca²⁺-independent and is mediated predominantly by the second EGF-like module. And mEMR4 is the first EGF-TM7 receptor known to mediate the cellular interaction between myeloid cells and B cells.

ADGRE4P Preparation Options

With years of experience and our advanced versatile Magic™ membrane protein production platform, Creative Biolabs is capable of providing one-stop and tailored membrane protein production services for global customers in the required formats using various strategies. Our professional scientists will work closely with you and help you find an ideal method to meet your specific requirements. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-ADGRE4P antibody development services.

In terms of our unparalleled technologies and years of experience in membrane protein preparation, Creative Biolabs is capable of providing one-stop and professional services for global clients. Our skilled scientists will do their best to greatly facilitate your project success. For more detailed information, please feel free to contact us.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: