Close

ADGRG6 Membrane Protein Introduction

Introduction of ADGRG6

ADGRG6, also known as developmentally regulated G-protein-coupled receptor (DREG) or G-protein coupled receptor 126 (GPR126), is a protein encoded by the ADGRG6 gene. As a member of the adhesion G protein-coupled receptor (aGPCR) family, ADGRG6 contains a seven-transmembrane domain and a long N-terminal region rich in functional motifs.

Basic Information of ADGRG6
Protein Name Adhesion G-protein coupled receptor G6
Gene Name ADGRG6
Aliases Developmentally regulated G-protein-coupled receptor, G-protein coupled receptor 126, Vascular inducible G protein-coupled receptor
Organism Homo sapiens (Human)
UniProt ID Q86SQ4
Transmembrane Times 7
Length (aa) 1250
Sequence MMFRSDRMWSCHWKWKPSPLLFLFALYIMCVPHSVWGCANCRVVLSNPSGTFTSPCYPNDYPNSQACMWT
LRAPTGYIIQITFNDFDIEEAPNCIYDSLSLDNGESQTKFCGATAKGLSFNSSANEMHVSFSSDFSIQKK
GFNASYIRVAVSLRNQKVILPQTSDAYQVSVAKSISIPELSAFTLCFEATKVGHEDSDWTAFSYSNASFT
QLLSFGKAKSGYFLSISDSKCLLNNALPVKEKEDIFAESFEQLCLVWNNSLGSIGVNFKRNYETVPCDST
ISKVIPGNGKLLLGSNQNEIVSLKGDIYNFRLWNFTMNAKILSNLSCNVKGNVVDWQNDFWNIPNLALKA
ESNLSCGSYLIPLPAAELASCADLGTLCQATVNSPSTTPPTVTTNMPVTNRIDKQRNDGIIYRISVVIQN
ILRHPEVKVQSKVAEWLNSTFQNWNYTVYVVNISFHLSAGEDKIKVKRSLEDEPRLVLWALLVYNATNNT
NLEGKIIQQKLLKNNESLDEGLRLHTVNVRQLGHCLAMEEPKGYYWPSIQPSEYVLPCPDKPGFSASRIC
FYNATNPLVTYWGPVDISNCLKEANEVANQILNLTADGQNLTSANITNIVEQVKRIVNKEENIDITLGST
LMNIFSNILSSSDSDLLESSSEALKTIDELAFKIDLNSTSHVNITTRNLALSVSSLLPGTNAISNFSIGL
PSNNESYFQMDFESGQVDPLASVILPPNLLENLSPEDSVLVRRAQFTFFNKTGLFQDVGPQRKTLVSYVM
ACSIGNITIQNLKDPVQIKIKHTRTQEVHHPICAFWDLNKNKSFGGWNTSGCVAHRDSDASETVCLCNHF
THFGVLMDLPRSASQLDARNTKVLTFISYIGCGISAIFSAATLLTYVAFEKLRRDYPSKILMNLSTALLF
LNLLFLLDGWITSFNVDGLCIAVAVLLHFFLLATFTWMGLEAIHMYIALVKVFNTYIRRYILKFCIIGWG
LPALVVSVVLASRNNNEVYGKESYGKEKGDEFCWIQDPVIFYVTCAGYFGVMFFLNIAMFIVVMVQICGR
NGKRSNRTLREEVLRNLRSVVSLTFLLGMTWGFAFFAWGPLNIPFMYLFSIFNSLQGLFIFIFHCAMKEN
VQKQWRQHLCCGRFRLADNSDWSKTATNIIKKSSDNLGKSLSSSSIGSNSTYLTSKSKSSSTTYFKRNSH
TDSASMDKSLSKLAHADGDQTSIIPVHQVIDKVKGYCNAHSDNFYKNIIMSDTFSHSTKF

Function of ADGRG6 Membrane Protein

During the past years, ADGRG6 has been widely studied. As a member of the adhesion GPCR family, it is extensively expressed on stromal cells and involved in cell-cell or cell-matrix adhesion. Studies have shown that ADGRG6 is associated with adult height, more specially trunk height, pulmonary function,and adolescent idiopathic scoliosis. It has been also reported that ADGRG6 is an evolutionarily conserved regulator of myelination. During development, ADGRG6 is thought to regulate cAMP concentration in SCs via interactions with G-proteins, and elevating cAMP in SCs upregulates the expression of myelin-related molecules. What’s more, ADGRG6 is required in multiple tissues during development including in the endocardium for normal heart development in the mouse, in Schwann cells for myelination of peripheral axons in zebrafish and in mouse and for inner ear development in zebrafish. And, ADGRG6 could stimulate VEGF signaling and angiogenesis by modulating VEGF receptor 2 (VEGFR2) expression through STAT5 and GATA2 in endothelial cells.

Adhesion GPCRs as Novel Actors in Neural and Glial Cell Functions.Fig.1 Adhesion GPCRs as Novel Actors in Neural and Glial Cell Functions. (Sigoillot, et.al. 2016)

Application of ADGRG6 Membrane Protein in Literature

1. Liu G, et.al. Genetic polymorphisms of GPR 126 are functionally associated with PUMC classifications of adolescent idiopathic scoliosis in a Northern Han population. Journal of cellular and molecular medicine. 2018, 22(3): 1964-71. PubMed ID: 29363878

This article reveals that locus of ADGRG6 is significantly associated with disease in northern Chinese Han Adolescent Idiopathic Scoliosis patients. The SNPs rs225694 and rs2294773 are associated with different AIS PUMC classifications.

2. Mogha A, et.al. Gpr126/Adgrg6 has Schwann cell autonomous and nonautonomous functions in peripheral nerve injury and repair. Journal of Neuroscience. 2016, 36(49): 12351-67. PubMed ID: 27927955

This article reveals that the adhesion class G protein-coupled receptor (GPCR) Gpr126/Adgrg6 is required for remyelination, macrophage recruitment, and axon regeneration following nerve injury. At least 30% of all approved drugs target GPCRs; thus, Gpr126 represents an attractive potential target to stimulate repair in myelin disease or following nerve injury.

3. Küffer A, et.al. The prion protein is an agonistic ligand of the G protein-coupled receptor Adgrg6. Nature. 2016, 536(7617): 464. PubMed ID: 27501152

This article suggests that the cellular prion protein PrP(C) could promote myelin homeostasis through flexible tail-mediated Gpr126 agonism. And these observations are relevant to the pathogenesis of demyelinating polyneuropathies-common debilitating diseases for which there are limited therapeutic options.

4. Karner CM, et.al. Gpr126/Adgrg6 deletion in cartilage models idiopathic scoliosis and pectus excavatum in mice. Human molecular genetics. 2015, 24(15): 4365-73. PubMed ID: 25954032

This article indicates that Gpr126 may be a genetic cause for the pathogenesis of AIS and PE in a mouse model.

5. Kitagaki J, et.al. A putative association of a single nucleotide polymorphism in GPR126 with aggressive periodontitis in a Japanese population. PloS one. 2016, 11(8): e0160765. PubMed ID: 27509131

This report reveals that GPR126 might be important in maintaining the homeostasis of periodontal ligament tissues through regulating the cytodifferentiation of HPDL cells. The GPR126SNP rs536714306 negatively influences this homeostasis, leading to the development of AgP, which indicates that it is a candidate genetic risk factor for AgP in the Japanese population

ADGRG6 Preparation Options

To meet every client’s specific requirements, we have developed Magic™ membrane protein production platform which enables us to provide numerous reconstitution forms as well as multiple active formats for the production of membrane protein. Our professional scientists are happy to help you find the perfect reconstitution form for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-ADGRG6 antibody development services.


With years of research on membrane protein preparation, Creative Biolabs now can offer unique protocol to meet our clients’ membrane protein preparation demands precisely. We are happy to tailor one-stop, custom-oriented service packages regarding a variety of membrane protein targets. If you are interested in our service, please do not hesitate to contact us for more details.

Reference

  1. Sigoillot, et al. (2016). Adhesion GPCRs as Novel Actors in Neural and Glial Cell Functions: From Synaptogenesis to Myelination. Handb Exp Pharmacol. 234, 275-298.

Online Inquiry

Verification code
Click image to refresh the verification code.

CONTACT US

45-1 Ramsey Road, Shirley, NY 11967, USA
Call us at:
USA: 1-631-381-2994
Europe: 44-207-097-1828
Fax: 1-631-207-8356
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us