Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of ADORA3
Adenosine receptor A3 (ADORA3) is a protein that in humans is encoded by the ADORA3 gene. The gene contains 2 exons separated by a single intron of about 2.2 kb. The A3 adenosine receptor is found to be expressed in Chinese hamster ovary cells and the agonist binds to membrane preparations inhibited cAMP accumulation. Pharmacologic characterization with several adenosine receptor agonists and xanthine antagonists showed that the human receptor is more similar to the sheep A3 adenosine receptor than to the rat A3 adenosine receptor. Adenosine released during cardiac ischemia exerts an effective, protective effect in the heart.
| Basic Information of ADORA3 | |
| Protein Name | Adenosine receptor A3 |
| Gene Name | ADORA3 |
| Aliases | A3 adenosine receptors |
| Organism | Homo sapiens (Human) |
| UniProt ID | P0DMS8 |
| Transmembrane Times | 7 |
| Length (aa) | 318 |
| Sequence |
MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC VVCHPSDSLDTSIEKNSE |
Function of ADORA3 Membrane Protein
The adenosine A3 receptor is expressed on cardiac ventricular cells, and its activation protects the ventricular heart cell against injury during a subsequent exposure to ischemia. The cardiac adenosine A3 receptor mediates a sustained cardioprotective function and it represents a new target for cardiac therapeutic. Cardiac atrial cells lack native A3 receptors and exhibited a shorter duration of cardioprotection than did ventricular cells. Transfection of atrial cells with cDNA encoding the human ADORA3 results in a sustained A3 agonist-mediated cardioprotection. Numerous studies have demonstrated the role of A3 adenosine receptor and signaling pathways in the multiple aspects of the tumor. There is also research about the function of ADORA3 in the biological processes of cancer stem cells (CSCs).
Fig.1 Schematic representation of second messengers and intracellular signaling pathways, downstream targets, mediated by A3ARs stimulation. (Borea, 2015)
Application of ADORA3 Membrane Protein in Literature
1. Cao H. L., et al. Cordycepin induces apoptosis in human bladder cancer cells via activation of A3 adenosine receptors. Tumour Biol. 2017, 39(7): 1010428317706915. PubMed ID: 28714368
This article reports that Cordyceps militaris hot water extracts containing cordycepin decreased T24 cell survival in a dose-dependent manner, which was seemingly mediated by activation of A3 adenosine receptor and the subsequent inactivation of Akt pathways, resulting in increases in cleaved Caspase-3 and apoptosis. Cordyceps militaris hot water extracts containing cordycepin may be a promising treatment for bladder cancer via A3 adenosine receptor activation.
2. Jafari SM., et al. A3 Adenosine Receptor Agonist Inhibited Survival of Breast Cancer Stem Cells via GLI-1 and ERK1/2 Pathway. J Cell Biochem. 2017, 118(9): 2909-2920. PubMed ID: 28230290
Authors in this group investigate the effect of A3AR agonist on breast cancer stem cells (BCSCs). The results show that A3 adenosine receptor agonist inhibited survival of breast cancer stem cells via GLI-1 and ERK1/2.
3. Joós G., et al. Involvement of adenosine A3 receptors in the chemotactic navigation of macrophages towards apoptotic cells. Immunol Lett. 2017, 183: 62-72. PubMed ID: 28188820
This article reports that adenosine A3 receptors are involved in the chemotactic navigation of macrophages towards apoptotic cells. Loss of A3Rs did not affect the in vivo clearance of apoptotic thymocytes in the dexamethasone-treated thymus.
4. Yang T., et al. Genetic Abrogation of Adenosine A3 Receptor Prevents Uninephrectomy and High Salt-Induced Hypertension. J Am Heart Assoc. 2016, 5(7). PubMed ID: 27431647
Authors in this group investigate the specific role of the A3 receptor in cardiovascular diseases. It shows that loss of ADORA3 signaling is strongly protective in this novel mouse model of renal and cardiovascular disease.
5. Wu W., et al. MicroRNA-206 is involved in the pathogenesis of ulcerative colitis via regulation of adenosine A3 receptor. Oncotarget. 2017, 8(1): 705-721. PubMed ID: 27893428
This article demonstrated that miR-206 has a proinflammatory role in UC by downregulating A3AR expression and activating NF-κB signaling.
ADORA3 Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-ADORA3 antibody development services.
Creative Biolabs now provides one-stop, custom-oriented membrane protein services and we are happy to leverage our advanced techniques and extensive expertise in this field to satisfy every single custom demand. Please do not hesitate to contact us for more information.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
