Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of ADRA2B
The alpha-2B adrenergic receptor (ADRA2B), is a G-protein coupled receptor that in humans is encoded by the ADRA2B gene. ADRA2B is a subtype of the adrenergic receptor family and has been identified in several mammals. ADRA2B orthologs have been identified in several mammals. α2-adrenergic receptors have 3 highly homologous subtypes: α2A, α2B, and α2C, all of which is essential in regulating neurotransmitter release from sympathetic nerves and from adrenergic neurons in the central nervous system. The ADRA2B gene encodes the α2B subtype, which was observed to associate with eIF-2B, a guanine nucleotide exchange protein that functions in regulation of translation.
| Basic Information of ADRA2B | |
| Protein Name | Alpha-2B adrenergic receptor |
| Gene Name | ADRA2B |
| Aliases | Alpha-2 adrenergic receptor subtype C2, Alpha-2B adrenoreceptor, Alpha-2B adrenoceptor, Alpha-2BAR, ADRA2L1, ADRA2RL1 |
| Organism | Homo sapiens (Human) |
| UniProt ID | P18089 |
| Transmembrane Times | 7 |
| Length (aa) | 450 |
| Sequence |
MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADIL VATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEY NSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGS FFAPCLIMILVYLRIYLIAKRSNRRGPRAKGGPGQGESKQPRPDHGGALASAKLPALASV ASAREVNGHSKSTGEKEEGETPEDTGTRALPPSWAALPNSGQGQKEGVCGASPEDEAEEE EEEEEEEEECEPQAVPVSPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRR AQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQFFFWIGYCNSS LNPVIYTIFNQDFRRAFRRILCRPWTQTAW |
Function of ADRA2B Membrane Protein
Several diseases are associated with ADRA2B including Epilepsy, Familial Adult Myoclonic, and Benign Adult Familial Myoclonic Epilepsy. Among its related pathways are response to elevated platelet cytosolic Ca2+ and Monoamine GPCRs. A deletion variant of the α2B adrenergic receptor has been shown to be associated with emotional memory. This variant also predisposed people who had it to focus more on negative aspects of a situation. The deletion variant of the ADRA2B gene is related to enhanced emotional memory and amygdala responses to emotional stimuli. It may increase susceptibility to post-traumatic stress disorder (PTSD) or related phenotypes by increasing the likelihood of traumatic memory formation. This tendency is still present in people who carry the variant gene and take a single dose of the noradrenergic antidepressant reboxetine but is attenuated in people without the variant.
Fig.1 Clinical uses of α2-Adrenergic Agonists. (Beak, 2017)
Application of ADRA2B Membrane Protein in Literature
1. Zoladz PR., et al. ADRA2B deletion variant influences time-dependent effects of pre-learning stress on long-term memory. Neurobiol Learn Mem. 2017, 140: 71-81. PubMed ID: 28254464
Authors in this group investigated whether ADRA2B deletion variant influences time-dependent effects of pre-learning stress on long-term memory. The accumulating evidence regarding this ADRA2B genetic variant implicates it as a susceptibility factor for traumatic memory formation and PTSD-related phenotypes.
2. Wirz L., et al. A Deletion Variant of the α2b-Adrenoceptor Modulates the Stress-Induced Shift from "Cognitive" to "Habit" Memory. J Neurosci. 2017, 37(8): 2149-2160. PubMed ID: 28115477
The article reports that carriers exhibited a significantly reduced bias toward habit memory after stress compared with noncarriers of the ADRA2B deletion variant. The variant modulates the stress-induced shift from cognitive to habit memory.
3. Luhrs L., et al. Function of brain α2B-adrenergic receptor characterized with subtype-selective α2B antagonist and KO mice. Neuroscience. 2016, 339: 608-621. PubMed ID: 27751959
The results show that α2B receptor is involved in CNS behaviors associated with sensorimotor gating and compulsivity. It may be therapeutically relevant for disorders such as schizophrenia, ADHD, post-traumatic stress disorder, addiction, and obsessive-compulsive disorder.
4. Mammarella N., et al. The modulating role of ADRA2B in emotional working memory: Attending the negative but remembering the positive. Neurobiol Learn Mem. 2016, 130: 129-34. PubMed ID: 26899992
Authors in this group investigated the role of ADRA2B in emotional working memory. The results show that deletion variants of ADRA2B may show greater levels of cognitive-affective flexibility compared to non-carriers.
5. Che P., et al. Spinophilin Is Indispensable for the α2B Adrenergic Receptor-Elicited Hypertensive Response. PLoS One. 2015, 10(8): e0135030. PubMed ID: 26244553
This article reveals that interaction with spinophilin is indispensable for the α2BAR to elicit the hypertensive response and spinophilin may represent a useful therapeutic target for treatment of hypertension.
ADRA2B Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-ADRA2B antibody development services.
As a leading service provider, scientists in Creative Biolabs are proud to present our professional service in membrane protein preparation. Please feel free to contact us for more details.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
