EDNRB Membrane Protein Introduction

Introduction of EDNRB

EDNRB, termed ETB, is a member of the endothelin receptor group of G-protein-coupled receptors that also containing ETA. These receptors, primarily present in vascular endothelial cells, play a role in vasoconstriction, vasodilation and cell proliferation. Its ligand, endothelin, a 21-amino-acid peptide, consists of a family of three potent vasoactive peptides: ET1, ET2, and ET3. EDNRB activates a phosphatidylinositol-calcium second messenger system.

Basic Information of EDNRB
Protein Name	Endothelin receptor type B
Gene Name	EDNRB
Aliases	ETB
Organism	Homo sapiens (Human)
UniProt ID	P24530
Transmembrane Times	7
Length (aa)	442
Sequence	MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNA SLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNS TLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFI QKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGF DIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEM LRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCEL LSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSC LKFKANDHGYDNFRSSNKYSSS

Function of EDNRB Membrane Protein

EDNRB, together with endothelin, are involved in the development of various diseases, including pulmonary arterial hypertension, and thus are important therapeutic targets. Studies suggest that mutations in the endothelin receptor type B gene contribute the multigenic disorder, Hirschsprung disease type 2. Endothelin-1 induces activation of the downstream MAP kinases (mainly) ERK1/2 by EDNRB but the exact mechanism is unclear. EDNRB is targeted to caveolae by binding to Caveolin-1. Research has shown that EDNRB dissociates from Caveolin-1 and exits from the caveolae after stimulation of endothelin-1. Caveolae localization of EDNRB is one of the mechanisms to ensure the balance of EDNRB -mediated signal transduction.

EDNRB Membrane Protein Introduction

Application of EDNRB Membrane Protein in Literature

Shihoya W., et al. Activation mechanism of endothelin ETB receptor by endothelin-1. Nature, 2016, 537: 363-368. PubMed ID: 27595334.

This article shows that crystal structures of human endothelin type B receptor and in complex with the endogenous agonist endothelin-1.
Mazzuca M., et al. Vascular endothelin receptor type B: structure, function and dysregulation in vascular disease. Biochem Pharmacol. 2012, 84(2): 147-62. PubMed ID: 22484314

This article suggests that the combination of ET(A)R antagonist with ET(B)R agonist may need to be evaluated in conditions associated with decreased endothelial ET(B)R expression/activity.
Polak J., et al. Blockade of Endothelin-1 Receptor Type B Ameliorates Glucose Intolerance and Insulin Resistance in a Mouse Model of Obstructive Sleep Apnea. Front Endocrinol (Lausanne). 2018, 9: 280. PubMed ID: 29896159

This article reveals that endothelin-1 receptor type B plays a role in IH-induced impairments in glucose homeostasis.
Stanhewicz A. E., et al. Alterations in endothelin type B receptor contribute to microvascular dysfunction in women who have had preeclampsia. Clin Sci (Lond). 2017, 131(23): 2777-2789. PubMed ID: 29042489

This article indicates that altered ETBR is involved in diminished endothelium-dependent dilation in women patients with previously preeclamptic.
Franzén S., et al. Intrarenal activation of endothelin type B receptors improves kidney oxygenation in type 1 diabetic rats. Am J Physiol Renal Physiol. 2018, 314(3): F439-F444. PubMed ID: 29092848

This article reveals that in the diabetic kidney increased ETB-R signaling improves intrarenal tissue oxygenation due to increased oxygen delivery secondary to increased renal blood flow.

EDNRB Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-EDNRB antibody development services.

As a forward-looking research institute as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: