Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of GJA5
The gap junction alpha-5 protein (GJA5) is a protein which is encoded by the GJA5 gene. It is also known as connexin-40 (Cx40). This gene is a member of the connexin gene family. The encoded protein is a component of the gap junction and consists of a series of intercellular channels that provide a pathway for the diffusion of low molecular weight species from cells to cells. Mutations in this gene may be involved in atrial fibrillation. A gap junction consists of a dense set of transmembrane channels, the linkers, through which low MW species diffuse from one cell to adjacent cells.
| Basic Information of GJA5 | |
| Protein Name | Gap junction alpha-5 protein |
| Gene Name | GJA5 |
| Aliases | Connexin-40 |
| Organism | Homo sapiens (Human) |
| UniProt ID | P36382 |
| Transmembrane Times | 4 |
| Length (aa) | 358 |
| Sequence | MGDWSFLGNFLEEVHKHSTVVGKVWLTVLFIFRMLVLGTAAESSWGDEQADFRCDTIQPGCQNVCYDQAFPISHIRYWVLQIIFVSTPSLVYMGHAMHTVRMQEKRKLREAERAKEVRGSGSYEYPVAEKAELSCWEEGNGRIALQGTLLNTYVCSILIRTTMEVGFIVGQYFIYGIFLTTLHVCRRSPCPHPVNCYVSRPTEKNVFIVFMLAVAALSLLLSLAELYHLGWKKIRQRFVKPRQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFFNPFSNNMASQQNTDNLVTEQVRGQEQTPGEGFIQVRYGQKPEVPNGVSPGHRLPHGYHSDKRRLSKASSKARSDDLSV |
Function of GJA5 Membrane Protein
GJA5 has been identified as a gene for observing the phenotype of congenital heart disease at 1q21.1. If there is repeated GJA5 quadruple disease, it is more common. Other congenital heart diseases are more common if there are other congenital heart diseases. The Cx family consists of 20 members, named according to their molecular weight. GJA5 is expressed in PASMCs. Previous studies have shown that GJA5 is involved in the development of edema and inflammation during certain lung injuries. However, it is unclear whether GJA5 will affect the progression of hyperoxia-induced acute lung injury.
Fig.1 Genetic Variants Identified by Genome-wide Association Studies. (Mahida, 2014)
Application of GJA5 Membrane Protein in Literature
This study adds to evidence supporting the importance of GJA5 alterations (especially reductions relative to Cx43) in AF.
It is pointed out herein that Cx37 is more important than GJA5 in relation to the release of essential NO, the release of cyclooxygenase products, and the regulation of ACh sensitivity.
The results indicate that loss of endothelial GJA5 can reduce tumor growth and blood vessels, independent of hypertension.
The authors found in vitro that sildenafil increased GJA5 expression in PASMCs isolated from MCT-PAH rats and inhibited proliferation of these cells.
This study showed that exposure to hypoxemia impaired the tight junction structure between vascular endothelial cells and decreased GJA5.
GJA5 Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-GJA5 antibody development services.
Creative Biolabs' skillful scientists are glad to leverage our expertise and advanced technologies to help you with the member protein research. If you are interested, please feel free to contact us for more details.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
