Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of GLP2R
The glucagon-like peptide 2 receptor (GLP2R) is a receptor protein encoded by the gene GLP2R. The G protein activates adenylate cyclase to mediate the activity of the GLP2R receptor. GLP2 signaling can stimulate intestinal growth and increase the villus height in the small intestine, accompanied by an increase in crypt cell proliferation and a decrease in intestinal cell apoptosis.
| Basic Information of GLP2R | |
| Protein Name | Glucagon-like peptide 2 receptor |
| Gene Name | GLP2R |
| Aliases | GLP-2-R |
| Organism | Homo sapiens (Human) |
| UniProt ID | O95838 |
| Transmembrane Times | 7 |
| Length (aa) | 553 |
| Sequence |
MKLGSSRAGPGRGSAGLLPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRPFLTLVLLVS IKQVTGSLLEETTRKWAQYKQACLRDLLKEPSGIFCNGTFDQYVCWPHSSPGNVSVPCPS YLPWWSEESSGRAYRHCLAQGTWQTIENATDIWQDDSECSENHSFKQNVDRYALLSTLQL MYTVGYSFSLISLFLALTLLLFLRKLHCTRNYIHMNLFASFILRTLAVLVKDVVFYNSYS KRPDNENGWMSYLSEMSTSCRSVQVLLHYFVGANYLWLLVEGLYLHTLLEPTVLPERRLW PRYLLLGWAFPVLFVVPWGFARAHLENTGCWTTNGNKKIWWIIRGPMMLCVTVNFFIFLK ILKLLISKLKAHQMCFRDYKYRLAKSTLVLIPLLGVHEILFSFITDDQVEGFAKLIRLFI QLTLSSFHGFLVALQYGFANGEVKAELRKYWVRFLLARHSGCRACVLGKDFRFLGKCPKK LSEGDGAEKLRKLQPSLNSGRLLHLAMRGLGELGAQPQQDHARWPRGSSLSECSEGDVTM ANTMEEILEESEI |
Function of GLP2R Membrane Protein
GLP2R is a receptor for glucagon-like peptide 2. Glucagon-like peptide-2 (GLP-2) is a 33 amino acid glucagon-derived peptide produced by enteroendocrine cells that can act as a growth factor to enlarge the surface area of mucosal epithelium. GLP2 binds to GLP2R to stimulate intestinal growth and up-regulate the villus height in the small intestine, accompanied by an increase in crypt cell proliferation and a decrease in intestinal cell apoptosis. In addition, GLP2 prevents intestinal hypoplasia caused by total parenteral nutrition.
Fig.1 Structure of GLP2R.
Application of GLP2R Membrane Protein in Literature
This research reports an important role in preventing intestinal mucosal damage and maintaining basal GLP-2R activity in normal host-bacterial interactions in the gastrointestinal tract.
This paper reveals that the central nervous system (CNS) GLP-2R plays an important physiological role in controlling food intake and gastric emptying. The melanocortin system mediates POMC neurons regulating CNS food intake and gastric emptying.
This article reveals that GLP-2R signaling plays an important role in the physiological and pharmacological control of amino acid perception and assimilation in the intestine.
This article suggests that GLP-2R activation contributes to the signaling pathways that promote normal intestinal epithelial cell proliferation and cytoprotection, but that sustained regulation of GLP-2R signaling does not alter the growth or survival of intestinal tumor cells.
Glucose intolerance and hepatic insulin resistance in mouse POMC neurons of the GLP-2 receptor (GLP-2R) are evaluated in this paper. GLP-2R activation is required for GLP-2 to enhance insulin-mediated inhibition of hepatic glucose production (HGP) and gluconeogenesis.
GLP2R Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-GLP2R antibody development services.
As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
