Close

GPRC5D Membrane Protein Introduction

Introduction of GPRC5D

GPRC5D is one of the orphan G-protein coupled receptors (GPCRs), with homology to members of family C GPCRs. A characteristic feature of the family C GPCRs is their unusually large extracellular amino-terminal domain (ATD) of about 500~600 amino acids, which is considerably longer than those seen in family A and B receptors. However, the GPRC5D receptor, together with RAIG1, GPRC5B, and GPRC5C, form a new group within family C based on their homology with members of this receptor family and the lack of homology to family A and B GPCRs. These receptors have short ATDs of about 30~50 amino acids.

Basic Information of GPRC5D
Protein Name G-protein coupled family C group 5 member D
Gene Name GPRC5D
Organism Homo sapiens (Human)
UniProt ID Q9NZD1
Transmembrane Times 7
Length (aa) 345
Sequence MYKDCIESTGDYFLLCDAEGPWGIILESLAILGIVVTILLLLAFLFLMRKIQDCSQWNVL
PTQLLFLLSVLGLFGLAFAFIIELNQQTAPVRYFLFGVLFALCFSCLLAHASNLVKLVRG
CVSFSWTTILCIAIGCSLLQIIIATEYVTLIMTRGMMFVNMTPCQLNVDFVVLLVYVLFL
MALTFFVSKATFCGPCENWKQHGRLIFITVLFSIIIWVVWISMLLRGNPQFQRQPQWDDP
VVCIALVTNAWVFLLLYIVPELCILYRSCRQECPLQGNACPVTAYQHSFQVENQELSRAR
DSDGAEEDVALTSYGTPIQPQTVDPTQECFIPQAKLSPQQDAGGV

Functions of GPRC5D Membrane Protein

GPRC5D proteins are found to be expressed in the peripheral system. The expression pattern is high in pancreas, medium in kidney, small intestine, spleen, and testis, low in lung, colon, leukocyte, prostate, and thymus, not detectable in brain, heart, liver, placenta, skeletal muscle, and ovary. Studies of this receptor indicate that it plays an important role in multiple myeloma diagnosis. However, studies of the regulation, molecular functions, and the involvement of this receptor in human diseases are required to be investigated further in the future.

GPRC5DMembrane Protein Introduction

Applications of GPRC5D Membrane Protein in Literature

  1. Bräuner-Osborne H., et al. Cloning and characterization of a human orphan family C G-protein coupled receptor GPRC5D. Biochimicaet Biophysica Acta (BBA)-Gene Structure and Expression. 2001, 1518(3): 237-248. PubMed ID: 11311935

    This article analyzed the protein sequences of family C metabotropic glutamate receptor-like receptors and the mRNA expression of GPRC5D membrane protein.

  2. Inoue S., et al. The RAIG family member, GPRC5D, is associated with hard-keratinized structures. Journal of Investigative Dermatology. 2004, 122(3): 565-573. PubMed ID: 15086536

    This article investigated the unique tissue distribution of GPRC5D, its mechanism of expression, and the effect of GPRC5D on acid hard keratins for understanding the molecular mechanisms of GPRC5D function in hard keratinization.

  3. Cohen Y., et al. GPRC5D is a promising marker for monitoring the tumor load and to target multiple myeloma cells. Hematology. 2013, 18(6): 348-351. PubMed ID: 23510526

    This article measured the gene expression in unsorted samples from patients with different cancer diseases before and after antimyeloma treatment. The authors found that the GPRC5D was a promising marker for monitoring the tumor load and hopefully also as targets for antimyeloma antibodies.

  4. Atamaniuk J., et al. Overexpression of G protein-coupled receptor 5D in the bone marrow is associated with poor prognosis in patients with multiple myeloma. European Journal of Clinical Investigation. 2012, 42(9): 953-960. PubMed ID: 22591013

    This article investigated the mRNA expression of GPRC5D in bone marrow of 48 patients with multiple myeloma. The data demonstrated that GPRC5D was a prognostic factor in multiple myeloma correlating with other major risk factors.

GPRC5D Preparation Options

Creative Biolabs offers high-quality membrane protein preparation services supported by our state-of-the-art Magic™ Membrane Protein Production Platform which efficiently generates and delivers functional solubilized targets with maximally preserved conformations and activities. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-GPRC5D antibody development services.


Our expert scientific staff has rich experience in difficult-to-prepare membrane proteins. Whether you want to purchase our services individually or included in your custom service contract, we can apply the experience to meet your needs. Contact us for more details about our membrane protein preparation services.

Online Inquiry

Verification code
Click image to refresh the verification code.

CONTACT US

45-1 Ramsey Road, Shirley, NY 11967, USA
Call us at:
USA: 1-631-381-2994
Europe: 44-207-097-1828
Fax: 1-631-207-8356
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us