Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CNIH2 (Cornichon family AMPA receptor auxiliary protein 2) Full Length (CAT#: MPC3109K) Made to Order

This product is a made-to-order Human CNIH2 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CNIH2
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 3
  • Sequence
  • MAFTFAAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARA
    RERLKNIERICCLLRKLVVPEYSIHGLFCLMFLCAAEWVTLGLNIPLLFY
    HLWRYFHRPADGSEVMYDAVSIMNADILNYCQKESWCKLAFYLLSFFYYL
    YSMVYTLVSF

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • CNIH2
  • Full Name
  • Cornichon family AMPA receptor auxiliary protein 2
  • Introduction
  • The protein encoded by this gene is an auxiliary subunit of the ionotropic glutamate receptor of the AMPA subtype. AMPA receptors mediate fast synaptic neurotransmission in the central nervous system. This protein has been reported to interact with the Type I AMPA receptor regulatory protein isoform gamma-8 to control assembly of hippocampal AMPA receptor complexes, thereby modulating receptor gating and pharmacology. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • CNIH2; Cnil; CNIH-2; protein cornichon homolog 2; cornichon homolog 2; Cornichon family AMPA receptor auxiliary protein 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us