Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human PLP2 (Proteolipid protein 2) Full Length (CAT#: MPC1113K) Made to Order

This product is a 16.6 kDa Human PLP2 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PLP2
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 16.6 kDa
  • TMD
  • 4
  • Sequence
  • MADSERLSAPGCWAACTNFSRTRKGILLFAEIILCLVILICFSASTPGYS
    SLSVIEMILAAIFFVVYMCDLHTKIPFINWPWSDFFRTLIAAILYLITSI
    VVLVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADG
    PV

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • PLP2
  • Full Name
  • Proteolipid protein 2
  • Introduction
  • This gene encodes an integral membrane protein that localizes to the endoplasmic reticulum in colonic epithelial cells. The encoded protein can multimerize and may function as an ion channel. A polymorphism in the promoter of this gene may be linked to an increased risk of X-linked cognitive disability. A pseudogene of this gene is found on chromosome 5.
  • Alternative Names
  • PLP2; A4; A4LSB; A4 differentiation-dependent protein; differentiation-dependent protein A4; intestinal membrane A4 protein; proteolipid protein 2 (colonic epithelium-enriched); Proteolipid protein 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us