Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SLC10A2 (Solute carrier family 10 member 2) Full Length (CAT#: MPC0717K) Made to Order

This product is a 37.7 kDa Human SLC10A2 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SLC10A2
  • Protein Length
  • Full length
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 37.7 kDa
  • TMD
  • 7
  • Sequence
  • MNDPNSCVDNATVCSGASCVVPESNFNNILSVVLSTVLTILLALVMFSMG
    CNVEIKKFLGHIKRPWGICVGFLCQFGIMPLTGFILSVAFDILPLQAVVV
    LIIGCCPGGTASNILAYWVDGDMDLSVSMTTCSTLLALGMMPLCLLIYTK
    MWVDSGSIVIPYDNIGTSLVSLVVPVSIGMFVNHKWPQKAKIILKIGSIA
    GAILIVLIAVVGGILYQSAWIIAPKLWIIGTIFPVAGYSLGFLLARIAGL
    PWYRCRTVAFETGMQNTQLCSTIVQLSFTPEELNVVFTFPLIYSIFQLAF
    AAIFLGFYVAYKKCHGKNKAEIPESKENGTEPESSFYKANGGFQPDEK

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • SLC10A2
  • Full Name
  • Solute carrier family 10 member 2
  • Introduction
  • This gene encodes a sodium/bile acid cotransporter. This transporter is the primary mechanism for uptake of intestinal bile acids by apical cells in the distal ileum. Bile acids are the catabolic product of cholesterol metabolism, so this protein is also critical for cholesterol homeostasis. Mutations in this gene cause primary bile acid malabsorption (PBAM); muatations in this gene may also be associated with other diseases of the liver and intestines, such as familial hypertriglyceridemia (FHTG).
  • Alternative Names
  • ASBT; IBAT; ISBT; PBAM; NTCP2; ileal sodium/bile acid cotransporter; Na(+)-dependent ileal bile acid transporter; ileal apical sodium-dependent bile acid transporter; ileal sodium-dependent bile acid transporter; sodium/taurocholate cotransporting polypeptide, ileal; solute carrier family 10 (sodium/bile acid cotransporter family), member 2; solute carrier family 10 (sodium/bile acid cotransporter), member 2; SLC10A2; Solute carrier family 10 member 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us