Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TNFSF8 (TNF superfamily member 8) expressed in CHO for Antibody Discovery (CAT#: MP0049Q)

This product is a 21 kDa Human TNFSF8 membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TNFSF8
  • Protein Length
  • Partial
  • Protein Class
  • Druggable Genome, Transmembrane
  • Molecular Weight
  • 21 kDa
  • TMD
  • 1
  • Sequence
  • HHHHHHHHPSPGGSGGQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD

Product Description

  • Expression Systems
  • CHO
  • Tag
  • His
  • Endotoxin
  • < 1 EU/µg
  • Purity
  • >95% as determined by SDS-PAGE and Coomassie blue staining
  • Buffer
  • 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2

Target

  • Target Protein
  • TNFSF8
  • Full Name
  • TNF superfamily member 8
  • Introduction
  • The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF8/CD30, which is a cell surface antigen and a marker for Hodgkin lymphoma and related hematologic malignancies. The engagement of this cytokine expressed on B cell surface plays an inhibitory role in modulating Ig class switch. This cytokine was shown to enhance cell proliferation of some lymphoma cell lines, while to induce cell death and reduce cell proliferation of other lymphoma cell lines. The pleiotropic biologic activities of this cytokine on different CD30+ lymphoma cell lines may play a pathophysiologic role in Hodgkin's and some non-Hodgkin's lymphomas. Two transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • CD30L; CD30LG; CD153; TNLG3A; CD153 antigen; CD30-L; CD30 antigen ligand; CD30 ligand; tumor necrosis factor (ligand) superfamily, member 8; tumor necrosis factor ligand 3A; Tumor necrosis factor ligand superfamily member 8

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us