Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of SLC46A2
SLC46A2, also known as TSCOT, is a member of the SLC46A family, and another member, SLC46A1, has been characterized as a proton-coupled folate transporter. This protein is encoded by SLC46A2 gene and has 475 acid amino acid residues. Topological analyses predict TSCOT protein possesses 12 transmembrane helices and a central inner loop without ATP binding domain. SLC46A2 is expressed in spleen, lymph nodes, thymus, PBL, bone marrow, and fetal liver.
| Basic Information of SLC46A2 | |
| Protein Name | Thymic stromal cotransporter homolog |
| Gene Name | SLC46A2 |
| Aliases | Ly110, TSCOT |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q9BY10 |
| Transmembrane Times | 12 |
| Length (aa) | 475 |
| Sequence | MSPEVTCPRRGHLPRFHPRTWVEPVVASSQVAASLYDAGLLLVVKASYGTGGSSNHSASPSPRGALEDQQQRAISNFYIIYNLVVGLSPLLSAYGLGWLSDRYHRKISICMSLLGFLLSRLGLLLKVLLDWPVEVLYGAAALNGLFGGFSAFWSGVMALGSLGSSEGRRSVRLILIDLMLGLAGFCGSMASGHLFKQMAGHSGQGLILTACSVSCASFALLYSLLVLKVPESVAKPSQELPAVDTVSGTVGTYRTLDPDQLDQQYAVGHPPSPGKAKPHKTTIALLFVGAIIYDLAVVGTVDVIPLFVLREPLGWNQVQVGYGMAAGYTIFITSFLGVLVFSRCFRDTTMIMIGMVSFGSGALLLAFVKETYMFYIARAVMLFALIPVTTIRSAMSKLIKGSSYGKVFVILQLSLALTGVVTSTLYNKIYQLTMDMFVGSCFALSSFLSFLAIIPISIVAYKQVPLSPYGDIIEK |
Function of SLC46A2 Membrane Protein
Although the biological and biochemical functions of SLC46A2 are still unclear, the structural features indicate it may act as a transporter to move small hydrophobic molecules. SLC46A2/TSCOT is a specific membrane protein of cortical thymic epithelial cells. It may involve the survival of thymic epithelial cells. Besides, it is also a necessary component to maintain normal lung epithelium. The loss of SLC46A2 function in lung epithelium may result in carcinogenesis progresses. Some studies have revealed that SLC46A2 may be a novel member of tumor suppressors. The inhibition of SLC46A2 has been detected in three types of lung cancers including large lung cell carcinoma, squamous lung carcinoma, and lung adenocarcinoma. Moreover, TSCOT also functions in the same way for the genetic type of cervical cancer susceptibility. TSCOT SNPs are associated with the susceptibility of cervical cancer. In addition, mammalian SLC46A2 also involves the stimulation of tracheal cytotoxin-triggered NOD1 activation in human epithelial cell lines, which suggests SLC46As contribute to cytosolic immune recognition.
Fig.1 Tissue and cell type specific TSCOT expression profiling. (Kim, 2015)
Application of SLC46A2 Membrane Protein in Literature
In this study, the authors find that mammalian SLC46A2s are involved in the stimulation of tracheal cytotoxin-triggered NOD1 activation in human epithelial cell lines.
The article demonstrates that Slc46A2 may be associated with the inhibition of lung tumor development.
The study reports that the introduction of a neoantigen into TSCOT-expressing cells can efficiently establish complete tolerance and suggests a possible application for the deletion of antigen-specific T cells by antigen introduction into TSCOT+ cells.
Authors identify that the human TSCOT locus (9q32) is mapped to the susceptibility of cervical cancer through the SNP study.
SLC46A2 Preparation Options
Based on the versatile Magic™ membrane protein production platform, Creative Biolabs can help you to obtain the best soluble and functional target protein to make your project a success. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-SLC46A2 antibody development services.
As a forward-looking biotech company as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. According to your special requirements, our experienced scientists are able to offer customized services. Please feel free to contact us for more information.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
