Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CD47 (CD47 molecule) for Antibody Discovery (CAT#: MP1305J)

This product is a 35.21 kDa Human CD47 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD47
  • Protein Length
  • Partial (19-141aa)
  • Protein Class
  • Druggable Genome, Transmembrane
  • Molecular Weight
  • 35.21 kDa
  • TMD
  • 5
  • Sequence
  • MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDG
    ALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPN
    ENILIVIFPIFAILLFWGQFGIKTLKYRSGGMDEKTIALLVAGLVITVIVIVGAILFVPGEYSLKNATGL
    GLIVTSTGILILLHYYVFSTAIGLTSFVIAILVIQVIAYILAVVGLSLCIAACIPMHGPLLISGLSILAL
    AQLLGLVYMKFVASNQKTIQPPRKAVEEPLNAFKESKGMMNDE

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • C-DDK/His
  • Purity
  • > 80% as determined by SDS-PAGE and Coomassie blue staining
  • Buffer
  • PBS, pH7.4, 10% glycerol

Target

  • Target Protein
  • CD47
  • Full Name
  • CD47 molecule
  • Introduction
  • This gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes. Alternatively spliced transcript variants have been found for this gene.
  • Alternative Names
  • IAP; OA3; MER6; CD47 antigen (Rh-related antigen, integrin-associated signal transducer); Rh-related antigen; antigen identified by monoclonal antibody 1D8; antigenic surface determinant protein OA3; integrin associated protein

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us