Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SCN2B (Sodium voltage-gated channel beta subunit 2) Full Length (CAT#: MPC0702K) Made to Order

This product is a 24.3 kDa Human SCN2B membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SCN2B
  • Protein Length
  • Full length
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 24.3 kDa
  • TMD
  • 1
  • Sequence
  • MHRDAWLPRPAFSLTGLSLFFSLVPPGRSMEVTVPATLNVLNGSDARLPC
    TFNSCYTVNHKQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVE
    FSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHGKIHLQVLMEE
    PPERDSTVAVIVGASVGGFLAVVILVLMVVKCVRRKKEQKLSTDDLKTEE
    EGKTDGEGNPDDGAK

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • SCN2B
  • Full Name
  • Sodium voltage-gated channel beta subunit 2
  • Introduction
  • The protein encoded by this gene is the beta 2 subunit of the type II voltage-gated sodium channel. The encoded protein is involved in cell-cell adhesion and cell migration. Defects in this gene can be a cause of Brugada Syndrome, atrial fibrillation, or sudden infant death syndrome.
  • Alternative Names
  • ATFB14; sodium channel subunit beta-2; neuronal voltage-gated sodium channel beta 2 subunit; sodium channel, voltage gated, type II beta subunit; sodium channel, voltage-gated, type II, beta polypeptide; SCN2B; Sodium voltage-gated channel beta subunit 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us