Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TMEM238L (Transmembrane protein 238 like) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX1012K)

This product is a Human TMEM238L membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TMEM238L
  • Protein Length
  • Full Length
  • Protein Class
  • Receptor
  • TMD
  • 2
  • Sequence
  • MLLGSLWGRCHPGCCALFLILALLLDAVGLVLLLLGILAPLSSWDFFIYTGALILALSLLLWIIWYSLNIEVSPEKLDL

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • TMEM238L
  • Full Name
  • Transmembrane protein 238 like
  • Alternative Names
  • TMEM238L; FORCP; LINC00675; FOXA1-Regulated Conserved Small Protein; long intergenic non-protein coding RNA 675; putative transmembrane protein LOC100289255; Transmembrane protein 238 like

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us