Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human PTPRJ (Protein tyrosine phosphatase receptor type J) Expressed in E.coli for Antibody Discovery, Partial (997-1337aa) (CAT#: MPX0399K)

This product is a 40 kDa Human PTPRJ membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PTPRJ
  • Protein Length
  • Partial (997-1337aa)
  • Protein Class
  • Protein phosphatase
  • Molecular Weight
  • 40 kDa
  • TMD
  • 1
  • Sequence
  • RKKR
    KDAKNNEVSFSQIKPKKSKLIRVENFEAYFKKQQADSNCGFAEEYEDLKL
    VGISQPKYAAELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYM
    PGYHSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCE
    EYWPSKQAQDYGDITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLRQFHF
    TSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFI
    AIDRLIYQIENENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLDIVR
    SQKDSKVDLIYQNTTAMTIYENLAPVTTFGKTNGYIA

Product Description

  • Activity
  • Yes
  • Expression Systems
  • E.coli
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Endotoxin
  • <1.0 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Supplied as a 0.2 μm filtered solution in Tris, NaCl, Glycerol and Betamercaptoethanol.

Target

  • Target Protein
  • PTPRJ
  • Full Name
  • Protein tyrosine phosphatase receptor type J
  • Introduction
  • The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes, including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region containing five fibronectin type III repeats, a single transmembrane region, and a single intracytoplasmic catalytic domain, and thus represents a receptor-type PTP. This protein is present in all hematopoietic lineages, and was shown to negatively regulate T cell receptor signaling possibly through interfering with the phosphorylation of Phospholipase C Gamma 1 and Linker for Activation of T Cells. This protein can also dephosphorylate the PDGF beta receptor, and may be involved in UV-induced signal transduction. Multiple transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • PTPRJ; DEP1; SCC1; CD148; HPTPeta; R-PTP-ETA; receptor-type tyrosine-protein phosphatase eta; CD148 antigen; DEP-1; HPTP eta; R-PTP-J; density-enhanced phosphatase 1; human density enhanced phosphatase-1; protein tyrosine phosphatase, receptor type, J polypeptide; protein-tyrosine phosphatase eta; susceptibility to colon cancer 1, mouse, homolog of; Protein tyrosine phosphatase receptor type J

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us