This product is an unconjugated anti-Human Complement C1QB Polyclonal antibody generated from the Mouse. The antibody can be used for WB; IHC.
Clonality | Polyclonal |
Host Animal | Mouse |
Isotype | IgG |
Immunogen | C1QB (1 a.a. - 253 a.a.) full-length human protein. MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA |
Species Reactivity | Human |
Applications | WB; IHC |
Application Notes | WB: 1:100-1:2000 IHC: 1:10-1:500 The optimal working dilutions should be determined by the end user. |
Specificity | This antibody reacts with Human complement C1QB. |
Purity | ≥95% as determined by SDS-PAGE |
Format | Liquid |
Size | 20; 100 µL |
Storage | Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. |
Type | Primary Antibody |
Target Name | C1QB |
Alternative Names | Complement C1q B Chain; Complement Component 1, Q Subcomponent, Beta Polypeptide; Complement Component 1, Q Subcomponent, B Chain; Complement C1q Subcomponent Subunit B; Complement C1q Chain B; Complement Subcomponent C1q Chain B; Complement Component C1q, B Chain; C1QB |
Gene ID | 713 |
UniProt ID | P02746 |
Introduction | C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca2+-dependent C1r2C1s2 proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes. |