This product is an anti-Human CD18 Polyclonal antibody generated from the Rabbit. The antibody can be used for WB; IF; IHC.
Clonality | Polyclonal |
Host Animal | Rabbit |
Isotype | IgG |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVHLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGV |
Species Reactivity | Human |
Applications | WB; IF; IHC |
Application Notes | WB: 0.04-0.4 µg/mL IF: 0.25-2 µg/mL IHC: 1:50 - 1:200 The optimal working dilutions should be determined by the end user. |
Specificity | This antibody reacts with Human CD18. |
Purity | ≥95% as determined by SDS-PAGE |
Format | Liquid |
Size | 100 µL |
Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Type | Primary Antibody |
Target Name | CD18 |
Alternative Names | Integrin Subunit Beta 2; Integrin, Beta 2 (Complement Component 3 Receptor 3 And 4 Subunit); Complement Component 3 Receptor 3 And 4 Subunit; Integrin, Beta 2 (Antigen CD18 (P95), Lymphocyte Function-Associated Antigen 1; Macrophage Antigen 1 (Mac-1) Beta Subunit); Cell Surface Adhesion Glycoprotein (LFA-1/CR3/P150,959 Beta Subunit Precursor); Cell Surface Adhesion Glycoproteins LFA-1/CR3/P150,95 Subunit Beta; Leukocyte-Associated Antigens CD18/11A, CD18/11B, CD18/11C; Leukocyte Cell Adhesion Molecule CD18; Complement Receptor C3 Beta-Subunit; Complement Receptor C3 Subunit Beta; Integrin Beta Chain, Beta 2; CD18 Antigen; LAD; CD18; MF17; MFI7; LCAMB; LFA-1; MAC-1 |
Gene ID | 3689 |
UniProt ID | P05107 |
Introduction | In molecular biology, CD18 (Integrin beta chain-2) is an integrin beta chain protein that is encoded by the ITGB2 gene in humans. Upon binding with one of a number of alpha chains, CD18 is capable of forming multiple heterodimers, which play significant roles in cellular adhesion and cell surface signaling, as well as important roles in immune responses. CD18 also exists in soluble, ligand binding forms. Deficiencies in CD18 expression can lead to adhesion defects in circulating white blood cells in humans, reducing the immune system's ability to fight off foreign invaders. The ITGB2 protein product is CD18. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain, and are crucial for cells to be able to efficiently bind to the extracellular matrix. This is especially important for neutrophils, as cellular adhesion plays a large role in extravasation from the blood vessels. A given chain may combine with multiple partners resulting in different integrins. |