Rabbit Anti-Human CD18 Polyclonal Antibody(Cat#: CTA-524)

This product is an anti-Human CD18 Polyclonal antibody generated from the Rabbit. The antibody can be used for WB; IF; IHC.

Summary Related Products & Services

Specifications
Clonality Polyclonal
Host Animal Rabbit
Isotype IgG
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: LEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVHLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGV
Species Reactivity Human
Applications WB; IF; IHC
Application Notes WB: 0.04-0.4 µg/mL
IF: 0.25-2 µg/mL
IHC: 1:50 - 1:200
The optimal working dilutions should be determined by the end user.
Specificity This antibody reacts with Human CD18.
Purity ≥95% as determined by SDS-PAGE
Format Liquid
Size 100 µL
Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Type Primary Antibody
Target
Target Name CD18
Alternative Names Integrin Subunit Beta 2; Integrin, Beta 2 (Complement Component 3 Receptor 3 And 4 Subunit); Complement Component 3 Receptor 3 And 4 Subunit; Integrin, Beta 2 (Antigen CD18 (P95), Lymphocyte Function-Associated Antigen 1; Macrophage Antigen 1 (Mac-1) Beta Subunit); Cell Surface Adhesion Glycoprotein (LFA-1/CR3/P150,959 Beta Subunit Precursor); Cell Surface Adhesion Glycoproteins LFA-1/CR3/P150,95 Subunit Beta; Leukocyte-Associated Antigens CD18/11A, CD18/11B, CD18/11C; Leukocyte Cell Adhesion Molecule CD18; Complement Receptor C3 Beta-Subunit; Complement Receptor C3 Subunit Beta; Integrin Beta Chain, Beta 2; CD18 Antigen; LAD; CD18; MF17; MFI7; LCAMB; LFA-1; MAC-1
Gene ID 3689
UniProt ID P05107
Information
Introduction In molecular biology, CD18 (Integrin beta chain-2) is an integrin beta chain protein that is encoded by the ITGB2 gene in humans. Upon binding with one of a number of alpha chains, CD18 is capable of forming multiple heterodimers, which play significant roles in cellular adhesion and cell surface signaling, as well as important roles in immune responses. CD18 also exists in soluble, ligand binding forms. Deficiencies in CD18 expression can lead to adhesion defects in circulating white blood cells in humans, reducing the immune system's ability to fight off foreign invaders. The ITGB2 protein product is CD18. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain, and are crucial for cells to be able to efficiently bind to the extracellular matrix. This is especially important for neutrophils, as cellular adhesion plays a large role in extravasation from the blood vessels. A given chain may combine with multiple partners resulting in different integrins.
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry