Rabbit Anti-Human CD93 Polyclonal Antibody(Cat#: CTA-371)

This product is an unconjugated anti-Human CD93 Polyclonal antibody generated from the Rabbit. The antibody can be used for WB; IF; IHC.

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number

TOP
Summary Related Products & Services

Specifications
Clonality Polyclonal
Host Animal Rabbit
Isotype IgG
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: FNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSSGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQKL
Species Reactivity Human
Applications WB; IF; IHC
Application Notes WB: 0.04-0.4 µg/mL
IF: 0.25-2 µg/mL
IHC: 1:50 - 1:200
The optimal working dilutions should be determined by the end user.
Specificity This antibody reacts with Human CD93.
Purity ≥95% as determined by SDS-PAGE
Format Liquid
Size 25; 100 µL
Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Type Primary Antibody
Target
Target Name C1QR
Alternative Names CD93 Molecule; CD93; Complement Component 1 Q Subcomponent Receptor 1; Complement Component C1q Receptor; C1q/MBL/SPA Receptor; C1QR1; C1qRP; C1qR; Complement Component 1, Q Subcomponent, Receptor 1; C1q Receptor 1; C1qRp; CD93
Gene ID 22918
UniProt ID Q9NPY3
Information
Introduction CD93 (Cluster of Differentiation 93) is a protein that in humans is encoded by the CD93 gene. CD93 is a C-type lectin transmembrane receptor which plays a role not only in cell-cell adhesion processes but also in host defense. CD93 was initially thought to be a receptor for C1q, but now is thought to instead be involved in intercellular adhesion and in the clearance of apoptotic cells. The intracellular cytoplasmic tail of this protein contains two highly conserved domains which may be involved in CD93 function. Indeed, the highly charged juxtamembrane domain has been found to interact with moesin, a protein known to play a role in linking transmembrane proteins to the cytoskeleton and in the remodelling of the cytoskeleton. This process appears crucial for both adhesion, migration and phagocytosis, three functions in which CD93 may be involved.
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry