This product is an unconjugated anti-Human CD93 Polyclonal antibody generated from the Rabbit. The antibody can be used for WB; IF; IHC.
Clonality | Polyclonal |
Host Animal | Rabbit |
Isotype | IgG |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSSGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQKL |
Species Reactivity | Human |
Applications | WB; IF; IHC |
Application Notes | WB: 0.04-0.4 µg/mL IF: 0.25-2 µg/mL IHC: 1:50 - 1:200 The optimal working dilutions should be determined by the end user. |
Specificity | This antibody reacts with Human CD93. |
Purity | ≥95% as determined by SDS-PAGE |
Format | Liquid |
Size | 25; 100 µL |
Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Type | Primary Antibody |
Target Name | C1QR |
Alternative Names | CD93 Molecule; CD93; Complement Component 1 Q Subcomponent Receptor 1; Complement Component C1q Receptor; C1q/MBL/SPA Receptor; C1QR1; C1qRP; C1qR; Complement Component 1, Q Subcomponent, Receptor 1; C1q Receptor 1; C1qRp; CD93 |
Gene ID | 22918 |
UniProt ID | Q9NPY3 |
Introduction | CD93 (Cluster of Differentiation 93) is a protein that in humans is encoded by the CD93 gene. CD93 is a C-type lectin transmembrane receptor which plays a role not only in cell-cell adhesion processes but also in host defense. CD93 was initially thought to be a receptor for C1q, but now is thought to instead be involved in intercellular adhesion and in the clearance of apoptotic cells. The intracellular cytoplasmic tail of this protein contains two highly conserved domains which may be involved in CD93 function. Indeed, the highly charged juxtamembrane domain has been found to interact with moesin, a protein known to play a role in linking transmembrane proteins to the cytoskeleton and in the remodelling of the cytoskeleton. This process appears crucial for both adhesion, migration and phagocytosis, three functions in which CD93 may be involved. |