This product is an unconjugated anti-Human CFHR2 Polyclonal antibody generated from the Rabbit. The antibody can be used for IHC.
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
| Clonality | Polyclonal |
| Host Animal | Rabbit |
| Isotype | IgG |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KLKWTNQQKLYSRTGDIVEFVCKSGYHPTKSHSFRAMCQNGKLVYPSCEE |
| Species Reactivity | Human |
| Applications | IHC |
| Application Notes | IHC: 1:50 - 1:200 The optimal working dilutions should be determined by the end user. |
| Specificity | This antibody reacts with Human CFHR2. |
| Purity | ≥95% as determined by SDS-PAGE |
| Format | Liquid |
| Size | 25; 100 µL |
| Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Type | Primary Antibody |
| Target Name | CFHR2 |
| Alternative Names | Complement Factor H Related 2; H Factor (Complement)-Like 3; H Factor-Like Protein 2; H Factor-Like 3; DDESK59; CFHL2; FHR-2; HFL3; FHR2; Complement Factor H-Related Protein 2; Complement Factor H-Related 2; Factor H-Related Gene 2 |
| Gene ID | 3080 |
| UniProt ID | P36980 |
| Introduction | Complement factor H-related protein 2 is a protein that in humans is encoded by the CFHR2 gene. Involved in complement regulation. The dimerized forms have avidity for tissue-bound complement fragments and efficiently compete with the physiological complement inhibitor CFH. Can associate with lipoproteins and may play a role in lipid metabolism. |