Rabbit Anti-Human CFHR2 Polyclonal Antibody(Cat#: CTA-412)
This product is an unconjugated anti-Human CFHR2 Polyclonal antibody generated from the Rabbit. The antibody can be used for IHC.
Summary
Related Products & Services
Specifications
| Clonality |
Polyclonal |
| Host Animal |
Rabbit |
| Isotype |
IgG |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: KLKWTNQQKLYSRTGDIVEFVCKSGYHPTKSHSFRAMCQNGKLVYPSCEE |
| Species Reactivity |
Human |
| Applications |
IHC |
| Application Notes |
IHC: 1:50 - 1:200
The optimal working dilutions should be determined by the end user. |
| Specificity |
This antibody reacts with Human CFHR2. |
| Purity |
≥95% as determined by SDS-PAGE |
| Format |
Liquid |
| Size |
25; 100 µL |
| Storage |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Type |
Primary Antibody |
Target
| Target Name |
CFHR2 |
| Alternative Names |
Complement Factor H Related 2; H Factor (Complement)-Like 3; H Factor-Like Protein 2; H Factor-Like 3; DDESK59; CFHL2; FHR-2; HFL3; FHR2; Complement Factor H-Related Protein 2; Complement Factor H-Related 2; Factor H-Related Gene 2 |
| Gene ID |
3080 |
| UniProt ID |
P36980 |
Information
| Introduction |
Complement factor H-related protein 2 is a protein that in humans is encoded by the CFHR2 gene. Involved in complement regulation. The dimerized forms have avidity for tissue-bound complement fragments and efficiently compete with the physiological complement inhibitor CFH. Can associate with lipoproteins and may play a role in lipid metabolism. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
