Rabbit Anti-Human Complement C1QB Polyclonal Antibody(Cat#: CTA-390)
This product is an unconjugated anti-Human Complement C1QB Polyclonal antibody generated from the Rabbit. The antibody can be used for WB; IHC.
Summary
Related Products & Services
Specifications
| Clonality |
Polyclonal |
| Host Animal |
Rabbit |
| Isotype |
IgG |
| Immunogen |
Synthetic peptides corresponding to C1QB(complement component 1, q subcomponent, B chain) The peptide sequence was selected from the C terminal of C1QB. Peptide sequence AYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD |
| Species Reactivity |
Human |
| Applications |
WB; IHC |
| Application Notes |
WB: 1:100-1:2000
IHC: 1:10-1:500
The optimal working dilutions should be determined by the end user. |
| Specificity |
This antibody reacts with Human complement C1QB. |
| Purity |
≥95% as determined by SDS-PAGE |
| Format |
Liquid |
| Size |
20; 100 µL |
| Storage |
Store at -20°C. Avoid freeze-thaw cycles. |
| Type |
Primary Antibody |
Target
| Target Name |
C1QB |
| Alternative Names |
B chain; complement C1q subcomponent subunit B; complement component 1; q subcomponent; B chain; complement subcomponent C1q chain B; q subcomponent; beta polypeptide |
| Gene ID |
713 |
| UniProt ID |
P02746 |
Information
| Introduction |
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca2+-dependent C1r2C1s2 proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
