Rabbit Anti-Human Complement C4BPB Polyclonal Antibody(Cat#: CTA-455)

This product is an unconjugated anti-Human Complement C4BPB Polyclonal antibody generated from the Rabbit. The antibody can be used for WB; IHC.

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number

TOP
Summary Related Products & Services

Specifications
Clonality Polyclonal
Host Animal Rabbit
Isotype IgG
Immunogen Synthetic peptides corresponding to C4BPB (complement component 4 binding protein, beta) The peptide sequence was selected from the N terminal of C4BPB. Peptide sequence CCLMVAWRVSASDAEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLV.
Species Reactivity Human
Applications WB; IHC
Application Notes WB: 1:100-1:2000
IHC: 1:10-1:500
The optimal working dilutions should be determined by the end user.
Specificity This antibody reacts with Human complement C4BPB.
Purity ≥95% as determined by SDS-PAGE
Format Liquid
Size 20; 100 µL
Storage Store at -20°C. Avoid freeze-thaw cycles.
Type Primary Antibody
Target
Target Name C4bPB
Alternative Names C4b binding protein beta chain; C4b-binding protein beta chain, C4BP; Complement component 4 binding protein, beta chain; Complement component 4-binding protein, beta
Gene ID 725
UniProt ID P20851
Information
Introduction C4b-binding protein beta chain is encoded by the human C4BPB gene. It controls the classical pathway of complement activation. It binds as a cofactor to C3b/C4b inactivator (C3bINA), which then hydrolyzes the complement fragment C4b. It also accelerates the degradation of the C4bC2a complex (C3 convertase) by dissociating the complement fragment C2a. It also interacts with anticoagulant protein S and with serum amyloid P component. The beta chain binds protein S.
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry