This product is an unconjugated anti-Human Complement C4BPB Polyclonal antibody generated from the Rabbit. The antibody can be used for WB; IHC.
Clonality | Polyclonal |
Host Animal | Rabbit |
Isotype | IgG |
Immunogen | Synthetic peptides corresponding to C4BPB (complement component 4 binding protein, beta) The peptide sequence was selected from the N terminal of C4BPB. Peptide sequence CCLMVAWRVSASDAEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLV. |
Species Reactivity | Human |
Applications | WB; IHC |
Application Notes | WB: 1:100-1:2000 IHC: 1:10-1:500 The optimal working dilutions should be determined by the end user. |
Specificity | This antibody reacts with Human complement C4BPB. |
Purity | ≥95% as determined by SDS-PAGE |
Format | Liquid |
Size | 20; 100 µL |
Storage | Store at -20°C. Avoid freeze-thaw cycles. |
Type | Primary Antibody |
Target Name | C4bPB |
Alternative Names | C4b binding protein beta chain; C4b-binding protein beta chain, C4BP; Complement component 4 binding protein, beta chain; Complement component 4-binding protein, beta |
Gene ID | 725 |
UniProt ID | P20851 |
Introduction | C4b-binding protein beta chain is encoded by the human C4BPB gene. It controls the classical pathway of complement activation. It binds as a cofactor to C3b/C4b inactivator (C3bINA), which then hydrolyzes the complement fragment C4b. It also accelerates the degradation of the C4bC2a complex (C3 convertase) by dissociating the complement fragment C2a. It also interacts with anticoagulant protein S and with serum amyloid P component. The beta chain binds protein S. |