This product is an unconjugated anti-Human Complement C8B Polyclonal antibody generated from the Rabbit. The antibody can be used for WB; IHC.
Clonality | Polyclonal |
Host Animal | Rabbit |
Isotype | IgG |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRKNTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS |
Species Reactivity | Human |
Applications | WB; IHC |
Application Notes | WB: 0.04-0.4 µg/mL IHC: 1:20 - 1:50 The optimal working dilutions should be determined by the end user. |
Specificity | This antibody reacts with Human complement C8B. |
Purity | ≥95% as determined by SDS-PAGE |
Format | Liquid |
Size | 100 µL |
Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Type | Primary Antibody |
Target Name | C8B |
Alternative Names | C82; Complement C8 Beta Chain; Complement Component 8; Beta Polypeptide; Complement Component 8 Subunit Beta; Complement Component C8 Beta Chain |
Gene ID | 732 |
UniProt ID | P07358 |
Introduction | Constituent of the membrane attack complex (MAC) that plays a key role in the innate and adaptive immune response by forming pores in the plasma membrane of target cells.it is one of the three subunits of the complement component 8 (C8) protein. C8 is composed of equimolar amounts of alpha, beta and gamma subunits, which are encoded by three separate genes. C8 is one component of the membrane attack complex, which mediates cell lysis, and it initiates membrane penetration of the complex. This protein mediates the interaction of C8 with the C5b-7 membrane attack complex precursor. In humans deficiency of this protein is associated with increased risk of meningococcal infections. |