Rabbit Anti-Human Complement C8B Polyclonal Antibody(Cat#: CTA-424)

This product is an unconjugated anti-Human Complement C8B Polyclonal antibody generated from the Rabbit. The antibody can be used for WB; IHC.

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number

TOP
Summary Related Products & Services

Specifications
Clonality Polyclonal
Host Animal Rabbit
Isotype IgG
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: PCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRKNTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS
Species Reactivity Human
Applications WB; IHC
Application Notes WB: 0.04-0.4 µg/mL
IHC: 1:20 - 1:50
The optimal working dilutions should be determined by the end user.
Specificity This antibody reacts with Human complement C8B.
Purity ≥95% as determined by SDS-PAGE
Format Liquid
Size 100 µL
Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Type Primary Antibody
Target
Target Name C8B
Alternative Names C82; Complement C8 Beta Chain; Complement Component 8; Beta Polypeptide; Complement Component 8 Subunit Beta; Complement Component C8 Beta Chain
Gene ID 732
UniProt ID P07358
Information
Introduction Constituent of the membrane attack complex (MAC) that plays a key role in the innate and adaptive immune response by forming pores in the plasma membrane of target cells.it is one of the three subunits of the complement component 8 (C8) protein. C8 is composed of equimolar amounts of alpha, beta and gamma subunits, which are encoded by three separate genes. C8 is one component of the membrane attack complex, which mediates cell lysis, and it initiates membrane penetration of the complex. This protein mediates the interaction of C8 with the C5b-7 membrane attack complex precursor. In humans deficiency of this protein is associated with increased risk of meningococcal infections.
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry