Rabbit Anti-Human Complement Factor H Polyclonal Antibody(Cat#: CTA-331)

This product is an unconjugated anti-Human Complement Factor H Polyclonal antibody generated from the Rabbit. The antibody can be used for WB; IHC.

Summary Related Products & Services

Specifications
Clonality Polyclonal
Host Animal Rabbit
Isotype IgG
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: CNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKA
Species Reactivity Human
Applications WB; IHC
Application Notes WB: 0.04-0.4 µg/mL
IHC: 1:200 - 1:500
The optimal working dilutions should be determined by the end user.
Specificity This antibody reacts with Human complement Factor H.
Purity ≥95% as determined by SDS-PAGE
Format Liquid
Size 25; 100 µL
Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Type Primary Antibody
Target
Target Name Factor H
Alternative Names Age-Related Maculopathy Susceptibility 1; H Factor 1 (Complement); H Factor 2 (Complement); Adrenomedullin Binding Protein; Beta-1-H-Globulin; Factor H-Like 1; H Factor 1; Factor H; Beta-1H; FH; HF; HF1; HF2; HUS; FHL1; AHUS1; AMBP1; ARMD4; ARMS1; CFHL3
Gene ID 3075
UniProt ID P08603
Information
Introduction Complement Factor H is a protein with twenty short consensus repeat domains encoded by human CFH gene. It is a member of the regulators of complement activation family and is a complement control protein. It is a large (155 kilodaltons), soluble glycoprotein that circulates in human plasma (at typical concentrations of 200-300 micrograms per milliliter). Factor H is secreted into the bloodstream and has an essential role in the regulation of complement activation, restricting this innate defense mechanism to microbial infections.
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry