Rabbit Anti-Human CR1 Polyclonal Antibody(Cat#: CTA-480)
This product is an anti-Human CR1 Polyclonal antibody generated from the Rabbit. The antibody can be used for WB; IHC.
Summary
Related Products & Services
Specifications
| Clonality |
Polyclonal |
| Host Animal |
Rabbit |
| Isotype |
IgG |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: VKCQALNKWEPELPSCSRVCQPPPDVLHAERTQRDKDNFSPGQEVFYSCE PGYDLRG |
| Species Reactivity |
Human |
| Applications |
WB; IHC |
| Application Notes |
WB: 0.04-0.4 µg/mL
IHC: 1:200 - 1:500
The optimal working dilutions should be determined by the end user. |
| Specificity |
This antibody reacts with Human CR1. |
| Purity |
≥95% as determined by SDS-PAGE |
| Format |
Liquid |
| Size |
25; 100 µL |
| Storage |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Type |
Primary Antibody |
Target
| Target Name |
CR1 |
| Alternative Names |
Complement C3b/C4b Receptor 1 (Knops Blood Group); Complement Component (3b/4b) Receptor 1 (Knops Blood Group); C3b/C4b Receptor; CD35 Antigen; C3BR; Complement Component (3b/4b) Receptor 1, Including Knops Blood Group System; Complement Component 3b/4b Receptor 1 (Knops Blood Group); Complement Receptor Type 1; Knops Blood Group Antigen; Complement Receptor 1; C3-Binding Protein; C4BR; CD35; KN |
| Gene ID |
1378 |
| UniProt ID |
P17927 |
Information
| Introduction |
Complement receptor 1 (CR1) also known as CD35, cluster of differentiation 35, is a protein that in humans is encoded by the CR1 gene. CR1 can act as a negative regulator of the complement cascade, mediate immune adherence and phagocytosis and inhibit both the classic and alternative pathways. Complement receptor 2 (CR2), also known as CD21, cluster of differentiation 21, is a protein that in humans is encoded by the CR2 gene. CR2 is involved in the complement system. It binds to iC3b (inactive derivative of C3b), C3dg, or C3d. B cells have CR2 receptors on their surfaces, allowing the complement system to play a role in B-cell activation and maturation. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
