Rabbit Anti-Human CR1 Polyclonal Antibody(Cat#: CTA-480)

Name: Rabbit Anti-Human CR1 Polyclonal Antibody
SKU: CTA-480
Rating: 5 (1 reviews)

This product is an anti-Human CR1 Polyclonal antibody generated from the Rabbit. The antibody can be used for WB; IHC.

INQUIRY

Datasheet

MSDS

COA

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number

TOP

Summary Related Products & Services

Specifications

Clonality	Polyclonal
Host Animal	Rabbit
Isotype	IgG
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: VKCQALNKWEPELPSCSRVCQPPPDVLHAERTQRDKDNFSPGQEVFYSCE PGYDLRG
Species Reactivity	Human
Applications	WB; IHC
Application Notes	WB: 0.04-0.4 µg/mL IHC: 1:200 - 1:500 The optimal working dilutions should be determined by the end user.
Specificity	This antibody reacts with Human CR1.
Purity	≥95% as determined by SDS-PAGE
Format	Liquid
Size	25; 100 µL
Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Type	Primary Antibody

Target

Target Name	CR1
Alternative Names	Complement C3b/C4b Receptor 1 (Knops Blood Group); Complement Component (3b/4b) Receptor 1 (Knops Blood Group); C3b/C4b Receptor; CD35 Antigen; C3BR; Complement Component (3b/4b) Receptor 1, Including Knops Blood Group System; Complement Component 3b/4b Receptor 1 (Knops Blood Group); Complement Receptor Type 1; Knops Blood Group Antigen; Complement Receptor 1; C3-Binding Protein; C4BR; CD35; KN
Gene ID	1378
UniProt ID	P17927

Information

Introduction

Complement receptor 1 (CR1) also known as CD35, cluster of differentiation 35, is a protein that in humans is encoded by the CR1 gene. CR1 can act as a negative regulator of the complement cascade, mediate immune adherence and phagocytosis and inhibit both the classic and alternative pathways. Complement receptor 2 (CR2), also known as CD21, cluster of differentiation 21, is a protein that in humans is encoded by the CR2 gene. CR2 is involved in the complement system. It binds to iC3b (inactive derivative of C3b), C3dg, or C3d. B cells have CR2 receptors on their surfaces, allowing the complement system to play a role in B-cell activation and maturation.

For Research Use Only. Not for Diagnostic or Therapeutic Applications.