Rabbit Anti-Human CR1 Polyclonal Antibody(Cat#: CTA-480)

This product is an anti-Human CR1 Polyclonal antibody generated from the Rabbit. The antibody can be used for WB; IHC.

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number

TOP
Summary Related Products & Services

Specifications
Clonality Polyclonal
Host Animal Rabbit
Isotype IgG
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: VKCQALNKWEPELPSCSRVCQPPPDVLHAERTQRDKDNFSPGQEVFYSCE PGYDLRG
Species Reactivity Human
Applications WB; IHC
Application Notes WB: 0.04-0.4 µg/mL
IHC: 1:200 - 1:500
The optimal working dilutions should be determined by the end user.
Specificity This antibody reacts with Human CR1.
Purity ≥95% as determined by SDS-PAGE
Format Liquid
Size 25; 100 µL
Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Type Primary Antibody
Target
Target Name CR1
Alternative Names Complement C3b/C4b Receptor 1 (Knops Blood Group); Complement Component (3b/4b) Receptor 1 (Knops Blood Group); C3b/C4b Receptor; CD35 Antigen; C3BR; Complement Component (3b/4b) Receptor 1, Including Knops Blood Group System; Complement Component 3b/4b Receptor 1 (Knops Blood Group); Complement Receptor Type 1; Knops Blood Group Antigen; Complement Receptor 1; C3-Binding Protein; C4BR; CD35; KN
Gene ID 1378
UniProt ID P17927
Information
Introduction Complement receptor 1 (CR1) also known as CD35, cluster of differentiation 35, is a protein that in humans is encoded by the CR1 gene. CR1 can act as a negative regulator of the complement cascade, mediate immune adherence and phagocytosis and inhibit both the classic and alternative pathways. Complement receptor 2 (CR2), also known as CD21, cluster of differentiation 21, is a protein that in humans is encoded by the CR2 gene. CR2 is involved in the complement system. It binds to iC3b (inactive derivative of C3b), C3dg, or C3d. B cells have CR2 receptors on their surfaces, allowing the complement system to play a role in B-cell activation and maturation.
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry