This product is an unconjugated anti-Human CD11c Monoclonal antibody (CTJS-472) generated from the Mouse. The antibody can be used for WB; IHC.
Clonality | Monoclonal |
Clone | CTJS-472 |
Host Animal | Mouse |
Isotype | IgG1 |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRV |
Species Reactivity | Human |
Applications | WB; IHC |
Application Notes | WB: 1 µg/mL IHC: 1:200 - 1:500 The optimal working dilutions should be determined by the end user. |
Specificity | This antibody reacts with Human CD11c. |
Purity | ≥95% as determined by SDS-PAGE |
Format | Liquid |
Size | 25; 100 µL |
Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Type | Primary Antibody |
Target Name | CD11c |
Alternative Names | Integrin Subunit Alpha X; Integrin, Alpha X (Complement Component 3 Receptor 4 Subunit); Complement Component 3 Receptor 4 Subunit; Integrin Alpha-X; CD11C; Integrin Alpha X; CD11c Antigen; ITGAX; CD11c |
Gene ID | 3687 |
UniProt ID | P20702 |
Introduction | CD11c, also known as Integrin, alpha X (complement component 3 receptor 4 subunit) (ITGAX), is a gene that encodes for CD11c . CD11c is an integrin alpha X chain protein. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This protein combines with the beta 2 chain (ITGB2) to form a leukocyte-specific integrin referred to as inactivated-C3b (iC3b) receptor 4 (CR4). The alpha X beta 2 complex seems to overlap the properties of the alpha M beta 2 integrin in the adherence of neutrophils and monocytes to stimulated endothelium cells, and in the phagocytosis of complement coated particles. CD11c is a type I transmembrane protein found at high levels on most human dendritic cells, but also on monocytes, macrophages, neutrophils, and some B cells that induces cellular activation and helps trigger neutrophil respiratory burst; expressed in hairy cell leukemias, acute nonlymphocytic leukemias, and some B-cell chronic lymphocytic leukemias. |