This product is an unconjugated anti-Human Complement C4BPA Polyclonal antibody generated from the Mouse. The antibody can be used for WB.
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
| Clonality | Polyclonal |
| Host Animal | Mouse |
| Isotype | IgG |
| Immunogen | C4BPA (1 a.a. - 597 a.a.) full-length human protein. MHPPKTPSGALHRKRKMAAWPFSRLWKVSDPILFQMTLIAALLPAVLGNCGPPPTLSFAAPMDITLTETRFKTGTTLKYTCLPGYVRSHSTQTLTCNSDGEWVYNTFCIYKRCRHPGELRNGQVEIKTDLSFGSQIEFSCSEGFFLIGSTTSRCEVQDRGVGWSHPLPQCEIVKCKPPPDIRNGRHSGEENFYAYGFSVTYSCDPRFSLLGHASISCTVENETIGVWRPSPPTCEKITCRKPDVSHGEMVSGFGPIYNYKDTIVFKCQKGFVLRGSSVIHCDADSKWNPSPPACEPNSCINLPDIPHASWETYPRPTKEDVYVVGTVLRYRCHPGYKPTTDEPTTVICQKNLRWTPYQGCEALCCPEPKLNNGEITQHRKSRPANHCVYFYGDEISFSCHETSRFSAICQGDGTWSPRTPSCGDICNFPPKIAHGHYKQSSSYSFFKEEIIYECDKGYILVGQAKLSCSYSHWSAPAPQCKALCRKPELVNGRLSVDKDQYVEPENVTIQCDSGYGVVGPQSITCSGNRTWYPEVPKCEWETPEGCEQVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL |
| Species Reactivity | Human |
| Applications | WB |
| Application Notes | The optimal working dilutions should be determined by the end user. |
| Specificity | This antibody reacts with Human complement C4BPA. |
| Purity | ≥95% as determined by SDS-PAGE |
| Format | Liquid |
| Size | 50 µg |
| Storage | Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. |
| Type | Primary Antibody |
| Target Name | C4bPA |
| Alternative Names | Complement Component 4 Binding Protein Alpha; Proline-Rich Protein; C4BP; PRP; Complement Component 4-Binding Protein, Alpha; C4b-Binding Protein Alpha Chain; C4bp; C4BP; Complement component 4-binding protein alpha |
| Gene ID | 722 |
| UniProt ID | P04003 |
| Introduction | C4b-binding protein alpha chain is encoded by the human C4BPA gene. It controls the classical pathway of complement activation. It binds as a cofactor to C3b/C4b inactivator (C3bINA), which then hydrolyzes the complement fragment C4b. It also accelerates the degradation of the C4bC2a complex (C3 convertase) by dissociating the complement fragment C2a. Alpha chain binds C4b. It interacts also with anticoagulant protein S and with serum amyloid P component. |