This product is an anti-Human CD11c Polyclonal antibody generated from the Rabbit. The antibody can be used for IHC.
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
| Clonality | Polyclonal |
| Host Animal | Rabbit |
| Isotype | IgG |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRV |
| Species Reactivity | Human |
| Applications | IHC |
| Application Notes | IHC: 1:50 - 1:200 The optimal working dilutions should be determined by the end user. |
| Specificity | This antibody reacts with Human CD11c. |
| Purity | ≥95% as determined by SDS-PAGE |
| Format | Liquid |
| Size | 25; 100 µL |
| Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Type | Primary Antibody |
| Target Name | CD11c |
| Alternative Names | 95 alpha chain; 95 alpha subunit; CD11 antigen-like family member C; CD11c antigen; CD11c; CD11Cleu M5; alpha subunit; Integrin alpha X; integrin alpha-X; integrin alpha X (antigen CD11C (p150); alpha polypeptide); integrin alpha X (complement component 3 receptor 4 subunit); ITGAX; Leu M5; Leukocyte adhesion glycoprotein p150; Leukocyte adhesion receptor p150; leukocyte surface antigen p150; myeloid membrane antigen; alpha subunit; p150 95 integrin alpha chain; p150 95 alpha; SLEB6 |
| Gene ID | 3687 |
| UniProt ID | P20702 |
| Introduction | CD11c, also known as Integrin, alpha X (complement component 3 receptor 4 subunit) (ITGAX), is a gene that encodes for CD11c . CD11c is an integrin alpha X chain protein. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This protein combines with the beta 2 chain (ITGB2) to form a leukocyte-specific integrin referred to as inactivated-C3b (iC3b) receptor 4 (CR4). The alpha X beta 2 complex seems to overlap the properties of the alpha M beta 2 integrin in the adherence of neutrophils and monocytes to stimulated endothelium cells, and in the phagocytosis of complement coated particles. CD11c is a type I transmembrane protein found at high levels on most human dendritic cells, but also on monocytes, macrophages, neutrophils, and some B cells that induces cellular activation and helps trigger neutrophil respiratory burst; expressed in hairy cell leukemias, acute nonlymphocytic leukemias, and some B-cell chronic lymphocytic leukemias. |