Rabbit Anti-Human CFHR4 Polyclonal Antibody(Cat#: CTA-398)

Name: Rabbit Anti-Human CFHR4 Polyclonal Antibody
SKU: CTA-398
Rating: 5 (1 reviews)

This product is an unconjugated anti-Human CFHR4 Polyclonal antibody generated from the Rabbit. The antibody can be used for WB.

INQUIRY

Datasheet

MSDS

COA

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number

TOP

Summary Related Products & Services

Specifications

Clonality	Polyclonal
Host Animal	Rabbit
Isotype	IgG
Immunogen	The immunogen for this antibody is CFHR4 - C-terminal region. Peptide sequence SNGEWSEPPRCIHPCIITEENMNKNNIQLKGKSDIKYYAKTGDTIEFMCK.
Species Reactivity	Human
Applications	WB
Application Notes	WB: 1:1000 The optimal working dilutions should be determined by the end user.
Specificity	This antibody reacts with Human CFHR4.
Purity	≥95% as determined by SDS-PAGE
Format	Liquid
Size	20; 100 µL
Storage	Store at -20°C. Avoid freeze-thaw cycles.
Type	Primary Antibody

Target

Target Name	CFHR4
Alternative Names	Complement Factor H-Related 4; FHR4; CFHL4; FHR-4
Gene ID	10877
UniProt ID	Q92496

Information

Introduction

Complement factor H-related protein 4 is a protein that in humans is encoded by the CFHR4 gene. it is involved in complement regulation. It can associate with lipoproteins and may play a role in lipid metabolism.

For Research Use Only. Not for Diagnostic or Therapeutic Applications.