Rabbit Anti-Human CFHR4 Polyclonal Antibody(Cat#: CTA-398)
This product is an unconjugated anti-Human CFHR4 Polyclonal antibody generated from the Rabbit. The antibody can be used for WB.
Summary
Related Products & Services
Specifications
| Clonality |
Polyclonal |
| Host Animal |
Rabbit |
| Isotype |
IgG |
| Immunogen |
The immunogen for this antibody is CFHR4 - C-terminal region. Peptide sequence SNGEWSEPPRCIHPCIITEENMNKNNIQLKGKSDIKYYAKTGDTIEFMCK. |
| Species Reactivity |
Human |
| Applications |
WB |
| Application Notes |
WB: 1:1000
The optimal working dilutions should be determined by the end user. |
| Specificity |
This antibody reacts with Human CFHR4. |
| Purity |
≥95% as determined by SDS-PAGE |
| Format |
Liquid |
| Size |
20; 100 µL |
| Storage |
Store at -20°C. Avoid freeze-thaw cycles. |
| Type |
Primary Antibody |
Target
| Target Name |
CFHR4 |
| Alternative Names |
Complement Factor H-Related 4; FHR4; CFHL4; FHR-4 |
| Gene ID |
10877 |
| UniProt ID |
Q92496 |
Information
| Introduction |
Complement factor H-related protein 4 is a protein that in humans is encoded by the CFHR4 gene. it is involved in complement regulation. It can associate with lipoproteins and may play a role in lipid metabolism. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
