Rabbit Anti-Human CFHR4 Polyclonal Antibody(Cat#: CTA-398)

This product is an unconjugated anti-Human CFHR4 Polyclonal antibody generated from the Rabbit. The antibody can be used for WB.

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number

TOP
Summary Related Products & Services

Specifications
Clonality Polyclonal
Host Animal Rabbit
Isotype IgG
Immunogen The immunogen for this antibody is CFHR4 - C-terminal region. Peptide sequence SNGEWSEPPRCIHPCIITEENMNKNNIQLKGKSDIKYYAKTGDTIEFMCK.
Species Reactivity Human
Applications WB
Application Notes WB: 1:1000
The optimal working dilutions should be determined by the end user.
Specificity This antibody reacts with Human CFHR4.
Purity ≥95% as determined by SDS-PAGE
Format Liquid
Size 20; 100 µL
Storage Store at -20°C. Avoid freeze-thaw cycles.
Type Primary Antibody
Target
Target Name CFHR4
Alternative Names Complement Factor H-Related 4; FHR4; CFHL4; FHR-4
Gene ID 10877
UniProt ID Q92496
Information
Introduction Complement factor H-related protein 4 is a protein that in humans is encoded by the CFHR4 gene. it is involved in complement regulation. It can associate with lipoproteins and may play a role in lipid metabolism.
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry