Rabbit Anti-Human Complement Factor B Polyclonal Antibody(Cat#: CTA-319)

This product is an unconjugated anti-Human Complement Factor B Polyclonal antibody generated from the Rabbit. The antibody can be used for WB; IF; IHC.

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number

TOP
Summary Related Products & Services

Specifications
Clonality Polyclonal
Host Animal Rabbit
Isotype IgG
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: KDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGMVWEHRKGTDYHKQPWQAKISVIRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYG
Species Reactivity Human; Mouse; Rat
Applications WB; IF; IHC
Application Notes WB: 0.04-0.4 µg/mL
IF: 0.25-2 µg/mL
IHC: 1:200 - 1:500
The optimal working dilutions should be determined by the end user.
Specificity This antibody reacts with Human, Mouse, Rat complement Factor B.
Purity ≥95% as determined by SDS-PAGE
Format Liquid
Size 25; 100 µL
Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Type Primary Antibody
Target
Target Name Factor B
Alternative Names B-Factor, Properdin; Properdin Factor B; C3/C5 Convertase; Glycine-Rich Beta-Glycoprotein; Glycine-Rich Beta Glycoprotein; C3 Proaccelerator; C3 Proactivator; EC 3.4.21.47; BF; FB; BFD; GBG; CFAB; CFBD; PBF2; AHUS4; FBI12; H2-Bf; ARMD14
Gene ID 629
UniProt ID P00751
Information
Introduction Complement factor B is a protein that in humans is encoded by the CFB gene. This gene encodes complement factor B, a component of the alternative pathway of complement activation. Factor B circulates in the blood as a single chain polypeptide. Upon activation of the alternative pathway, it is cleaved by complement factor D yielding the noncatalytic chain Ba and the catalytic subunit Bb. The active subunit Bb is a serine protease that associates with C3b to form the alternative pathway C3 convertase. Bb is involved in the proliferation of preactivated B lymphocytes, while Ba inhibits their proliferation. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. This cluster includes several genes involved in regulation of the immune reaction. The polyadenylation site of this gene is 421 bp from the 5' end of the gene for complement component 2.
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry