Rabbit Anti-Human CFHR1 Polyclonal Antibody-CTA-404(Cat#: CTA-404)

This product is an unconjugated anti-Human CFHR1 Polyclonal antibody generated from the Rabbit. The antibody can be used for WB; IF; IHC.

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number

TOP
Summary Related Products & Services

Specifications
Clonality Polyclonal
Host Animal Rabbit
Isotype IgG
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: TGESAEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCA
Species Reactivity Human
Applications WB; IF; IHC
Application Notes WB: 0.04-0.4 µg/mL
IF: 0.25-2 µg/mL
IHC: 1:50 - 1:200
The optimal working dilutions should be determined by the end user.
Specificity This antibody reacts with Human CFHR1.
Purity ≥95% as determined by SDS-PAGE
Format Liquid
Size 100 µL
Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Type Primary Antibody
Target
Target Name CFHR1
Alternative Names Complement Factor H Related 1; Complement Factor H-Related 1 Pseudogene; H Factor (Complement)-Like 1; H Factor (Complement)-Like 2; H Factor-Like Protein 1; H-Factor-Like 1; Complement Factor H-Related Protein 1; Complement Factor H-Related 1; CFHL; FHR1; HFL1; HFL2; CFHL1; H36-1; H36-2; CFHL1P; CFHR1P
Gene ID 3078
UniProt ID Q03591
Information
Introduction Complement factor H-related protein 1 is a protein that in humans is encoded by the CFHR1 gene. This gene encodes a secreted protein belonging to the complement factor H protein family. It binds to Pseudomonas aeruginosa elongation factor Tuf together with plasminogen, which is proteolytically activated. It is proposed that Tuf acts as a virulence factor by acquiring host proteins to the pathogen surface, controlling complement, and facilitating tissue invasion. Mutations in this gene are associated with an increased risk of atypical hemolytic-uremic syndrome.
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry