Rabbit Anti-Human CFHR1 Polyclonal Antibody-CTA-404(Cat#: CTA-404)
This product is an unconjugated anti-Human CFHR1 Polyclonal antibody generated from the Rabbit. The antibody can be used for WB; IF; IHC.
Summary
Related Products & Services
Specifications
| Clonality |
Polyclonal |
| Host Animal |
Rabbit |
| Isotype |
IgG |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: TGESAEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCA |
| Species Reactivity |
Human |
| Applications |
WB; IF; IHC |
| Application Notes |
WB: 0.04-0.4 µg/mL
IF: 0.25-2 µg/mL
IHC: 1:50 - 1:200
The optimal working dilutions should be determined by the end user. |
| Specificity |
This antibody reacts with Human CFHR1. |
| Purity |
≥95% as determined by SDS-PAGE |
| Format |
Liquid |
| Size |
100 µL |
| Storage |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Type |
Primary Antibody |
Target
| Target Name |
CFHR1 |
| Alternative Names |
Complement Factor H Related 1; Complement Factor H-Related 1 Pseudogene; H Factor (Complement)-Like 1; H Factor (Complement)-Like 2; H Factor-Like Protein 1; H-Factor-Like 1; Complement Factor H-Related Protein 1; Complement Factor H-Related 1; CFHL; FHR1; HFL1; HFL2; CFHL1; H36-1; H36-2; CFHL1P; CFHR1P |
| Gene ID |
3078 |
| UniProt ID |
Q03591 |
Information
| Introduction |
Complement factor H-related protein 1 is a protein that in humans is encoded by the CFHR1 gene. This gene encodes a secreted protein belonging to the complement factor H protein family. It binds to Pseudomonas aeruginosa elongation factor Tuf together with plasminogen, which is proteolytically activated. It is proposed that Tuf acts as a virulence factor by acquiring host proteins to the pathogen surface, controlling complement, and facilitating tissue invasion. Mutations in this gene are associated with an increased risk of atypical hemolytic-uremic syndrome. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
