This product is an unconjugated anti-Human CFHR1 Polyclonal antibody generated from the Rabbit. The antibody can be used for WB; IF; IHC.
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
| Clonality | Polyclonal |
| Host Animal | Rabbit |
| Isotype | IgG |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TGESAEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCA |
| Species Reactivity | Human |
| Applications | WB; IF; IHC |
| Application Notes | WB: 0.04-0.4 µg/mL IF: 0.25-2 µg/mL IHC: 1:50 - 1:200 The optimal working dilutions should be determined by the end user. |
| Specificity | This antibody reacts with Human CFHR1. |
| Purity | ≥95% as determined by SDS-PAGE |
| Format | Liquid |
| Size | 100 µL |
| Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Type | Primary Antibody |
| Target Name | CFHR1 |
| Alternative Names | Complement Factor H Related 1; Complement Factor H-Related 1 Pseudogene; H Factor (Complement)-Like 1; H Factor (Complement)-Like 2; H Factor-Like Protein 1; H-Factor-Like 1; Complement Factor H-Related Protein 1; Complement Factor H-Related 1; CFHL; FHR1; HFL1; HFL2; CFHL1; H36-1; H36-2; CFHL1P; CFHR1P |
| Gene ID | 3078 |
| UniProt ID | Q03591 |
| Introduction | Complement factor H-related protein 1 is a protein that in humans is encoded by the CFHR1 gene. This gene encodes a secreted protein belonging to the complement factor H protein family. It binds to Pseudomonas aeruginosa elongation factor Tuf together with plasminogen, which is proteolytically activated. It is proposed that Tuf acts as a virulence factor by acquiring host proteins to the pathogen surface, controlling complement, and facilitating tissue invasion. Mutations in this gene are associated with an increased risk of atypical hemolytic-uremic syndrome. |