Rabbit Anti-Human MASP1 Polyclonal Antibody(Cat#: CTA-460)

This product is an unconjugated anti-Human MASP1 Polyclonal antibody generated from the Rabbit. The antibody can be used for IF.

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number

TOP
Summary Related Products & Services

Specifications
Clonality Polyclonal
Host Animal Rabbit
Isotype IgG
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: PCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPT
Species Reactivity Human
Applications IF
Application Notes IF: 0.25-2 µg/mL
The optimal working dilutions should be determined by the end user.
Specificity This antibody reacts with Human MASP1.
Purity ≥95% as determined by SDS-PAGE
Format Liquid
Size 25; 100 µL
Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Type Primary Antibody
Target
Target Name MASP1
Alternative Names Mannan Binding Lectin Serine Peptidase 1; Complement-Activating Component Of Ra-Reactive Factor; Mannose-Binding Lectin-Associated Serine Protease 1; Mannose-Binding Protein-Associated Serine Protease; C4/C2 Activating Component Of Ra-Reactive Factor; Ra-Reactive Factor Serine Protease P100; Complement Factor MASP-3; Serine Protease; CRARF1; CRARF; PRSS5; RaRF; Mannan-Binding Lectin Serine Peptidase 1 (C4/C2 Activating Component Of Ra-Reactive Factor); Mannan-Binding Lectin Serine Protease 1 (C4/C2 Activating Component Of Ra-Reactive Factor); Mannan-Binding Lectin Serine Protease 1; EC 3.4.21.; MASP-1; MASP3; MAp44; 3MC1; MAP1; MASP
Gene ID 5648
UniProt ID P48740
Information
Introduction Mannan-binding lectin serine protease 1 also known as mannose-associated serine protease 1 (MASP-1) is an enzyme that in humans is encoded by the MASP1 gene. MASP-1 is involved in the lectin pathway of the complement system and is responsible for cleaving C4 and C2 to form C4b2a, a C3-convertase. MASP-1 is a serine protease that functions as a component of the lectin pathway of complement activation. The complement pathway plays an essential role in the innate and adaptive immune response. MASP-1 is synthesized as a zymogen and is activated when it complexes with the pathogen recognition molecules of lectin pathway, the mannose-binding lectin and the ficolins. This protein is not directly involved in complement activation but may play a role as an amplifier of complement activation by cleaving complement C2 or by activating another complement serine protease, MASP-2. MASP-1 is also able to cleave fibrinogen and factor XIII and may be involved in coagulation. A splice variant of this gene which lacks the serine protease domain functions as an inhibitor of the complement pathway.
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry