Rabbit Anti-Human MASP1 Polyclonal Antibody(Cat#: CTA-460)
This product is an unconjugated anti-Human MASP1 Polyclonal antibody generated from the Rabbit. The antibody can be used for IF.
Summary
Related Products & Services
Specifications
Clonality |
Polyclonal |
Host Animal |
Rabbit |
Isotype |
IgG |
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: PCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPT |
Species Reactivity |
Human |
Applications |
IF |
Application Notes |
IF: 0.25-2 µg/mL The optimal working dilutions should be determined by the end user. |
Specificity |
This antibody reacts with Human MASP1. |
Purity |
≥95% as determined by SDS-PAGE |
Format |
Liquid |
Size |
25; 100 µL |
Storage |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Type |
Primary Antibody |
Target
Target Name |
MASP1 |
Alternative Names |
Mannan Binding Lectin Serine Peptidase 1; Complement-Activating Component Of Ra-Reactive Factor; Mannose-Binding Lectin-Associated Serine Protease 1; Mannose-Binding Protein-Associated Serine Protease; C4/C2 Activating Component Of Ra-Reactive Factor; Ra-Reactive Factor Serine Protease P100; Complement Factor MASP-3; Serine Protease; CRARF1; CRARF; PRSS5; RaRF; Mannan-Binding Lectin Serine Peptidase 1 (C4/C2 Activating Component Of Ra-Reactive Factor); Mannan-Binding Lectin Serine Protease 1 (C4/C2 Activating Component Of Ra-Reactive Factor); Mannan-Binding Lectin Serine Protease 1; EC 3.4.21.; MASP-1; MASP3; MAp44; 3MC1; MAP1; MASP |
Gene ID |
5648 |
UniProt ID |
P48740 |
Information
Introduction |
Mannan-binding lectin serine protease 1 also known as mannose-associated serine protease 1 (MASP-1) is an enzyme that in humans is encoded by the MASP1 gene. MASP-1 is involved in the lectin pathway of the complement system and is responsible for cleaving C4 and C2 to form C4b2a, a C3-convertase. MASP-1 is a serine protease that functions as a component of the lectin pathway of complement activation. The complement pathway plays an essential role in the innate and adaptive immune response. MASP-1 is synthesized as a zymogen and is activated when it complexes with the pathogen recognition molecules of lectin pathway, the mannose-binding lectin and the ficolins. This protein is not directly involved in complement activation but may play a role as an amplifier of complement activation by cleaving complement C2 or by activating another complement serine protease, MASP-2. MASP-1 is also able to cleave fibrinogen and factor XIII and may be involved in coagulation. A splice variant of this gene which lacks the serine protease domain functions as an inhibitor of the complement pathway. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.