This product is an unconjugated anti-Human MASP1 Polyclonal antibody generated from the Rabbit. The antibody can be used for IF.
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
| Clonality | Polyclonal |
| Host Animal | Rabbit |
| Isotype | IgG |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPT |
| Species Reactivity | Human |
| Applications | IF |
| Application Notes | IF: 0.25-2 µg/mL The optimal working dilutions should be determined by the end user. |
| Specificity | This antibody reacts with Human MASP1. |
| Purity | ≥95% as determined by SDS-PAGE |
| Format | Liquid |
| Size | 25; 100 µL |
| Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Type | Primary Antibody |
| Target Name | MASP1 |
| Alternative Names | Mannan Binding Lectin Serine Peptidase 1; Complement-Activating Component Of Ra-Reactive Factor; Mannose-Binding Lectin-Associated Serine Protease 1; Mannose-Binding Protein-Associated Serine Protease; C4/C2 Activating Component Of Ra-Reactive Factor; Ra-Reactive Factor Serine Protease P100; Complement Factor MASP-3; Serine Protease; CRARF1; CRARF; PRSS5; RaRF; Mannan-Binding Lectin Serine Peptidase 1 (C4/C2 Activating Component Of Ra-Reactive Factor); Mannan-Binding Lectin Serine Protease 1 (C4/C2 Activating Component Of Ra-Reactive Factor); Mannan-Binding Lectin Serine Protease 1; EC 3.4.21.; MASP-1; MASP3; MAp44; 3MC1; MAP1; MASP |
| Gene ID | 5648 |
| UniProt ID | P48740 |
| Introduction | Mannan-binding lectin serine protease 1 also known as mannose-associated serine protease 1 (MASP-1) is an enzyme that in humans is encoded by the MASP1 gene. MASP-1 is involved in the lectin pathway of the complement system and is responsible for cleaving C4 and C2 to form C4b2a, a C3-convertase. MASP-1 is a serine protease that functions as a component of the lectin pathway of complement activation. The complement pathway plays an essential role in the innate and adaptive immune response. MASP-1 is synthesized as a zymogen and is activated when it complexes with the pathogen recognition molecules of lectin pathway, the mannose-binding lectin and the ficolins. This protein is not directly involved in complement activation but may play a role as an amplifier of complement activation by cleaving complement C2 or by activating another complement serine protease, MASP-2. MASP-1 is also able to cleave fibrinogen and factor XIII and may be involved in coagulation. A splice variant of this gene which lacks the serine protease domain functions as an inhibitor of the complement pathway. |