Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ADAM15 (ADAM metallopeptidase domain 15) Expressed in CHO for Antibody Discovery, Partial (207-693aa) (CAT#: MPX0483K)

This product is a 53 kDa Human ADAM15 membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ADAM15
  • Protein Length
  • Partial (207-693aa)
  • Protein Class
  • Cell adhesion
  • Molecular Weight
  • 53 kDa
  • TMD
  • 1
  • Sequence
  • DVVTETKTVELVIVADHSEAQKYRDFQHLLNRTLEVALLLDTFF
    RPLNVRVALVGLEAWTQRDLVEISPNPAVTLENFLHWRRAHLLPRLPHDS
    AQLVTGTSFSGPTVGMAIQNSICSPDFSGGVNMDHSTSILGVASSIAHEL
    GHSLGLDHDLPGNSCPCPGPAPAKTCIMEASTDFLPGLNFSNCSRRALEK
    ALLDGMGSCLFERLPSLPPMAAFCGNMFVEPGEQCDCGFLDDCVDPCCDS
    LTCQLRPGAQCASDGPCCQNCQLRPSGWQCRPTRGDCDLPEFCPGDSSQC
    PPDVSLGDGEPCAGGQAVCMHGRCASYAQQCQSLWGPGAQPAAPLCLQTA
    NTRGNAFGSCGRNPSGSYVSCTPRDAICGQLQCQTGRTQPLLGSIRDLLW
    ETIDVNGTELNCSWVHLDLGSDVAQPLLTLPGTACGPGLVCIDHRCQRVD
    LLGAQECRSKCHGHGVCDSNRHCYCEEGWAPPDCTTQLKATSS

Product Description

  • Activity
  • Yes
  • Expression Systems
  • CHO
  • Tag
  • 10xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 500 μg/mL in water.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in MES and NaCl.

Target

  • Target Protein
  • ADAM15
  • Full Name
  • ADAM metallopeptidase domain 15
  • Introduction
  • The protein encoded by this gene is a member of the ADAM (a disintegrin and metalloproteinase) protein family. ADAM family members are type I transmembrane glycoproteins known to be involved in cell adhesion and proteolytic ectodomain processing of cytokines and adhesion molecules. This protein contains multiple functional domains including a zinc-binding metalloprotease domain, a disintegrin-like domain, as well as a EGF-like domain. Through its disintegrin-like domain, this protein specifically interacts with the integrin beta chain, beta 3. It also interacts with Src family protein-tyrosine kinases in a phosphorylation-dependent manner, suggesting that this protein may function in cell-cell adhesion as well as in cellular signaling. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.
  • Alternative Names
  • ADAM15; MDC15; disintegrin and metalloproteinase domain-containing protein 15; MDC-15; a disintegrin and metalloproteinase domain 15 (metargidin); metalloprotease RGD disintegrin protein; metalloproteinase-like, disintegrin-like, and cysteine-rich protein 15; ADAM metallopeptidase domain 15

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us