Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FAM174A (Family with sequence similarity 174 member A) for Antibody Discovery (CAT#: MP1468X)

This product is a 46.4 kDa Human FAM174A membrane protein expressed in In vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FAM174A
  • Protein Length
  • Full-length
  • Molecular Weight
  • 46.4 kDa
  • TMD
  • 1
  • Sequence
  • MKASQCCCCLSHLLASVLLLLLLPELSGPLAVLLQAAEAAPGLGPPDPRPRTLPPLPPGPTPAQQPGRGLAEAAGPRGSEGGNGSNPVAGLETDDHGGKAGEGSVGGGLAVSPNPGDKPMTQRALTVLMVVSGAVLVYFVVRTVRMRRRNRKTRRYGVLDTNIENMELTPLEQDDEDDDNTLFDANHPRR

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Protein Format
  • Liposome
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0

Target

  • Target Protein
  • FAM174A
  • Full Name
  • Family with sequence similarity 174 member A
  • Introduction
  • The FAM174A gene is conserved in chimpanzee, Rhesus monkey, dog, mouse, rat, chicken, and frog.
  • Alternative Names
  • NS5ATP6; TMEM157; UNQ1912; HGS_RE408; membrane protein FAM174A; HCV NS5A-transactivated protein 6; hepatitis C virus NS5A-transactivated protein 6; hepatitis C virus nonstructural protein 5A trans-activated protein 6; transmembrane protein 157

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us