Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FPR1 (Formyl peptide receptor 1) Expressed in E.coli with 10xHis and GST tag at the N-terminus, Myc tag at the C-terminus for Antibody Discovery, Partial (306-350aa) (CAT#: MPX4314K)

This product is a 34.9 kDa Human FPR1 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FPR1
  • Protein Length
  • Partial (306-350aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 34.9 kDa
  • TMD
  • 7
  • Sequence
  • QDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 10xHis and GST tag at the N-terminus, Myc tag at the C-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • FPR1
  • Full Name
  • Formyl peptide receptor 1
  • Introduction
  • This gene encodes a G protein-coupled receptor of mammalian phagocytic cells that is a member of the G-protein coupled receptor 1 family. The protein mediates the response of phagocytic cells to invasion of the host by microorganisms and is important in host defense and inflammation.
  • Alternative Names
  • FPR; FMLP; fMet-Leu-Phe receptor; N-formylpeptide chemoattractant receptor; fMLP receptor; FPR1; Formyl peptide receptor 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us