Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human GPRC5D (G protein-coupled receptor class C group 5 member D) Expressed in Wheat germ for Antibody Discovery, Partial (261-345aa) (CAT#: MPX0039K)

This product is a 37 kDa Human GPRC5D membrane protein expressed in Wheat germ. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • GPRC5D
  • Protein Length
  • Partial (261-345aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 37 kDa
  • TMD
  • 7
  • Sequence
  • ELCILYRSCRQECPLQGNACPVTAYQHSFQVENQELSRARDSDGAEEDVALTSYGTPIQPQTVDPTQECFIPQAKLSPQQDAGGV

Product Description

  • Expression Systems
  • Wheat germ
  • Tag
  • GST tag at N-terminus
  • Protein Format
  • Soluble
  • Endotoxin
  • <0.1 EU/μg by the LAL method
  • Buffer
  • pH: 8.00, Constituents: 0.31% Glutathione, 0.79% Tris HCl

Target

  • Target Protein
  • GPRC5D
  • Full Name
  • G protein-coupled receptor class C group 5 member D
  • Introduction
  • The protein encoded by this gene is a member of the G protein-coupled receptor family; however, the specific function of this gene has not yet been determined.
  • Alternative Names
  • G-protein coupled receptor family C group 5 member D; orphan G-protein coupled receptor; GPRC5D; G protein-coupled receptor class C group 5 member D

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us