Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ICOS (Inducible T cell costimulator) Expressed in CHO for Antibody Discovery, Partial (21-134aa) (CAT#: MPX0178K)

This product is a 14 kDa Human ICOS membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ICOS
  • Protein Length
  • Partial (21-134aa)
  • Protein Class
  • Cell adhesion
  • Molecular Weight
  • 14 kDa
  • TMD
  • 1
  • Sequence
  • EINGSANYEMFIFHNGGVQILCKYPDIVQQ
    FKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLD
    HSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQ

Product Description

  • Expression Systems
  • CHO
  • Tag
  • 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 200 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose.

Target

  • Target Protein
  • ICOS
  • Full Name
  • Inducible T cell costimulator
  • Introduction
  • The protein encoded by this gene belongs to the CD28 and CTLA-4 cell-surface receptor family. It forms homodimers and plays an important role in cell-cell signaling, immune responses, and regulation of cell proliferation.
  • Alternative Names
  • ICOS; AILIM; CD278; CVID1; inducible T-cell costimulator; activation-inducible lymphocyte immunomediatory molecule; inducible T-cell co-stimulator; inducible costimulator; Inducible T cell costimulator

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us