Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human KCNK15 (Potassium two pore domain channel subfamily K member 15) Full Length (CAT#: MPC0620K) Made to Order

This product is a 36.1 kDa Human KCNK15 membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KCNK15
  • Protein Length
  • Full length
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 36.1 kDa
  • TMD
  • 4
  • Sequence
  • MRRPSVRAAGLVLCTLCYLLVGAAVFDALESEAESGRQRLLVQKRGALRR
    KFGFSAEDYRELERLALQAEPHRAGRQWKFPGSFYFAITVITTIGYGHAA
    PGTDSGKVFCMFYALLGIPLTLVTFQSLGERLNAVVRRLLLAAKCCLGLR
    WTCVSTENLVVAGLLACAATLALGAVAFSHFEGWTFFHAYYYCFITLTTI
    GFGDFVALQSGEALQRKLPYVAFSFLYILLGLTVIGAFLNLVVLRFLVAS
    ADWPERAARPPSPRPPGAPESRGLWLPRRPARSVGSASVFCHVHKLERCA
    RDNLGFSPPSSPGVVRGGQAPRPGARWKSI

Product Description

  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • KCNK15
  • Full Name
  • Potassium two pore domain channel subfamily K member 15
  • Introduction
  • This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity.
  • Alternative Names
  • KT3.3; TASK5; KCNK11; KCNK14; TASK-5; K2p15.1; dJ781B1.1; potassium channel subfamily K member 15; TWIK-related acid-sensitive K(+) channel 5; TWIK-related acid-sensitive K+ 5; acid-sensitive potassium channel protein TASK-5; potassium channel, subfamily K, member 14; potassium channel, two pore domain subfamily K, member 15; two pore K(+) channel KT3.3; two pore potassium channel KT3.3; KCNK15; Potassium two pore domain channel subfamily K member 15

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us