Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human MC1R (Melanocortin 1 receptor) Full Length (CAT#: MPC0288K) Made to Order

This product is a 34.7 kDa Human MC1R membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • MC1R
  • Protein Length
  • Full length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 34.7 kDa
  • TMD
  • 7
  • Sequence
  • MAVQGSQRRLLGSLNSTPTAIPQLGLAANQTGARCLEVSISDGLFLSLGL
    VSLVENALVVATIAKNRNLHSPMYCFICCLALSDLLVSGSNVLETAVILL
    LEAGALVARAAVLQQLDNVIDVITCSSMLSSLCFLGAIAVDRYISIFYAL
    RYHSIVTLPRARRAVAAIWVASVVFSTLFIAYYDHVAVLLCLVVFFLAML
    VLMAVLYVHMLARACQHAQGIARLHKRQRPVHQGFGLKGAVTLTILLGIF
    FLCWGPFFLHLTLIVLCPEHPTCGCIFKNFNLFLALIICNAIIDPLIYAF
    HSQELRRTLKEVLTCSW

Product Description

  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • MC1R
  • Full Name
  • Melanocortin 1 receptor
  • Introduction
  • This intronless gene encodes the receptor protein for melanocyte-stimulating hormone (MSH). The encoded protein, a seven pass transmembrane G protein coupled receptor, controls melanogenesis. Two types of melanin exist: red pheomelanin and black eumelanin. Gene mutations that lead to a loss in function are associated with increased pheomelanin production, which leads to lighter skin and hair color. Eumelanin is photoprotective but pheomelanin may contribute to UV-induced skin damage by generating free radicals upon UV radiation. Binding of MSH to its receptor activates the receptor and stimulates eumelanin synthesis. This receptor is a major determining factor in sun sensitivity and is a genetic risk factor for melanoma and non-melanoma skin cancer. Over 30 variant alleles have been identified which correlate with skin and hair color, providing evidence that this gene is an important component in determining normal human pigment variation.
  • Alternative Names
  • CMM5; MSH-R; SHEP2; melanocyte-stimulating hormone receptor; MC1-R; alpha melanocyte stimulating hormone receptor; melanotropin receptor; MC1R; Melanocortin 1 receptor

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us