Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SEC61G (SEC61 translocon subunit gamma) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX3664K)

This product is a Human SEC61G membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SEC61G
  • Protein Length
  • Full Length
  • Protein Class
  • Transport
  • TMD
  • 1
  • Sequence
  • MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • SEC61G
  • Full Name
  • SEC61 translocon subunit gamma
  • Introduction
  • The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. Oligomers of the Sec61 complex form a transmembrane channel where proteins are translocated across and integrated into the ER membrane. This complex consists of three membrane proteins- alpha, beta, and gamma. This gene encodes the gamma-subunit protein. Alternatively spliced transcript variants encoding the same protein have been identified.
  • Alternative Names
  • SEC61G; SSS1; protein transport protein Sec61 subunit gamma; SEC61 translocon gamma subunit; Sec61 gamma subunit; protein transport protein SEC61 gamma subunit; SEC61 translocon subunit gamma

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us