Rabbit Anti-Human/Mouse/Rat Collectin-11 Polyclonal Antibody(Cat#: CTA-1088)

This product is an unconjugated anti-Human/Mouse/Rat Collectin-11 Polyclonal antibody generated from the Rabbit. The antibody can be used for IHC.

Summary Related Products & Services

Specifications
Clonality Polyclonal
Host Animal Rabbit
Isotype IgG
Immunogen INDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM
Species Reactivity Human; Mouse; Rat; Hamster
Applications IHC
Application Notes IHC: 1:200-1:500
The optimal working dilutions should be determined by the end user.
Specificity This antibody reacts with Human, Mouse, Rat, and Hamster Collectin-11.
Purity ≥95% as determined by SDS-PAGE
Conjugation Unconjugated
Format Liquid
Size 25; 100 µL
Storage Store at 4°C for short term. Store at -20°C for long term. Avoid freeze-thaw cycle.
Type Primary Antibody
Target
Target Name Collectin-11
Alternative Names Collectin Subfamily Member 11; Collectin Kidney Protein 1; Collectin K1; Collectin-11; CL-K1; Collectin Sub-Family Member 11; CL-K1-Iia; CL-K1-Iib; CL-K1-II; COLEC11; 3MC2; CLK1
Gene ID 78989
UniProt ID Q9BWP8
Information
Introduction Collectin-11 (CL-11) is a lectin that plays a role in innate immunity, apoptosis and embryogenesis. Calcium-dependent lectin that binds self and non-self glycoproteins presenting high mannose oligosaccharides with at least one terminal alpha-1,2-linked mannose epitope. Primarily recognizes the terminal disaccharide of the glycan. Also recognizes a subset of fucosylated glycans and lipopolysaccharides. Plays a role in innate immunity through its ability to bind non-self sugars presented by microorganisms and to activate the complement through the recruitment of MAPS1. Also plays a role in apoptosis through its ability to bind in a calcium-independent manner the DNA present at the surface of apoptotic cells and to activate the complement in response to this binding. Finally, plays a role in development, probably serving as a guidance cue during the migration of neural crest cells and other cell types during embryogenesis.
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry