This product is an unconjugated anti-Human/Mouse/Rat Collectin-11 Polyclonal antibody generated from the Rabbit. The antibody can be used for IHC.
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
| Clonality | Polyclonal |
| Host Animal | Rabbit |
| Isotype | IgG |
| Immunogen | INDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM |
| Species Reactivity | Human; Mouse; Rat; Hamster |
| Applications | IHC |
| Application Notes | IHC: 1:200-1:500 The optimal working dilutions should be determined by the end user. |
| Specificity | This antibody reacts with Human, Mouse, Rat, and Hamster Collectin-11. |
| Purity | ≥95% as determined by SDS-PAGE |
| Conjugation | Unconjugated |
| Format | Liquid |
| Size | 25; 100 µL |
| Storage | Store at 4°C for short term. Store at -20°C for long term. Avoid freeze-thaw cycle. |
| Type | Primary Antibody |
| Target Name | Collectin-11 |
| Alternative Names | Collectin Subfamily Member 11; Collectin Kidney Protein 1; Collectin K1; Collectin-11; CL-K1; Collectin Sub-Family Member 11; CL-K1-Iia; CL-K1-Iib; CL-K1-II; COLEC11; 3MC2; CLK1 |
| Gene ID | 78989 |
| UniProt ID | Q9BWP8 |
| Introduction | Collectin-11 (CL-11) is a lectin that plays a role in innate immunity, apoptosis and embryogenesis. Calcium-dependent lectin that binds self and non-self glycoproteins presenting high mannose oligosaccharides with at least one terminal alpha-1,2-linked mannose epitope. Primarily recognizes the terminal disaccharide of the glycan. Also recognizes a subset of fucosylated glycans and lipopolysaccharides. Plays a role in innate immunity through its ability to bind non-self sugars presented by microorganisms and to activate the complement through the recruitment of MAPS1. Also plays a role in apoptosis through its ability to bind in a calcium-independent manner the DNA present at the surface of apoptotic cells and to activate the complement in response to this binding. Finally, plays a role in development, probably serving as a guidance cue during the migration of neural crest cells and other cell types during embryogenesis. |