Rabbit Anti-Human/Mouse/Rat Collectin-11 Polyclonal Antibody(Cat#: CTA-1088)
This product is an unconjugated anti-Human/Mouse/Rat Collectin-11 Polyclonal antibody generated from the Rabbit. The antibody can be used for IHC.
Summary
Related Products & Services
Specifications
Clonality |
Polyclonal |
Host Animal |
Rabbit |
Isotype |
IgG |
Immunogen |
INDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM |
Species Reactivity |
Human; Mouse; Rat; Hamster |
Applications |
IHC |
Application Notes |
IHC: 1:200-1:500 The optimal working dilutions should be determined by the end user. |
Specificity |
This antibody reacts with Human, Mouse, Rat, and Hamster Collectin-11. |
Purity |
≥95% as determined by SDS-PAGE |
Conjugation |
Unconjugated |
Format |
Liquid |
Size |
25; 100 µL |
Storage |
Store at 4°C for short term. Store at -20°C for long term. Avoid freeze-thaw cycle. |
Type |
Primary Antibody |
Target
Target Name |
Collectin-11 |
Alternative Names |
Collectin Subfamily Member 11; Collectin Kidney Protein 1; Collectin K1; Collectin-11; CL-K1; Collectin Sub-Family Member 11; CL-K1-Iia; CL-K1-Iib; CL-K1-II; COLEC11; 3MC2; CLK1 |
Gene ID |
78989 |
UniProt ID |
Q9BWP8 |
Information
Introduction |
Collectin-11 (CL-11) is a lectin that plays a role in innate immunity, apoptosis and embryogenesis. Calcium-dependent lectin that binds self and non-self glycoproteins presenting high mannose oligosaccharides with at least one terminal alpha-1,2-linked mannose epitope. Primarily recognizes the terminal disaccharide of the glycan. Also recognizes a subset of fucosylated glycans and lipopolysaccharides. Plays a role in innate immunity through its ability to bind non-self sugars presented by microorganisms and to activate the complement through the recruitment of MAPS1. Also plays a role in apoptosis through its ability to bind in a calcium-independent manner the DNA present at the surface of apoptotic cells and to activate the complement in response to this binding. Finally, plays a role in development, probably serving as a guidance cue during the migration of neural crest cells and other cell types during embryogenesis. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.