Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human BST2 (Bone marrow stromal cell antigen 2) Full Length (CAT#: MPC1776K) Made to Order

This product is a 19.7 kDa Human BST2 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • BST2
  • Protein Length
  • Full length
  • Protein Class
  • Immunity
  • Molecular Weight
  • 19.7 kDa
  • TMD
  • 1
  • Sequence
  • MASTSYDYCRVPMEDGDKRCKLLLGIGILVLLIIVILGVPLIIFTIKANS
    EACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMA
    SLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIAD
    KKYYPSSQDSSSAAAPQLLIVLLGLSALLQ

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • BST2
  • Full Name
  • Bone marrow stromal cell antigen 2
  • Introduction
  • Bone marrow stromal cells are involved in the growth and development of B-cells. The specific function of the protein encoded by the bone marrow stromal cell antigen 2 is undetermined; however, this protein may play a role in pre-B-cell growth and in rheumatoid arthritis.
  • Alternative Names
  • BST2; CD317; HM1.24; TETHERIN; bone marrow stromal antigen 2; BST-2; HM1.24 antigen; NPC-A-7; antiviral factor tetherin; Bone marrow stromal cell antigen 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us