Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CD302 (CD302 molecule) Expressed in HEK293 for Antibody Discovery, Partial (23-167aa) (CAT#: MPX0583K)

This product is a 43 kDa Human CD302 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD302
  • Protein Length
  • Partial (23-167aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 43 kDa
  • TMD
  • 1
  • Sequence
  • DCPSSTWIQFQDSCYIFLQEAIKVESIE
    DVRNQCTDHGADMISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDDA
    SFKWFDNSNMTFDKWTDQDDDEDLVDTCAFLHIKTGEWKKGNCEVSSVEG
    TLCKTAIPYKRKYLSDN

Product Description

  • Activity
  • Yes
  • Expression Systems
  • HEK293
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 500 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >90%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • CD302
  • Full Name
  • CD302 molecule
  • Introduction
  • CD302 is a C-type lectin receptor involved in cell adhesion and migration, as well as endocytosis and phagocytosis.
  • Alternative Names
  • CD302; DCL1; DCL-1; BIMLEC; CLEC13A; CD302 antigen; C-type lectin domain family 13, member A; DEC205-associated C-type lectin 1; type I transmembrane C-type lectin receptor DCL-1; CD302 molecule

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us