Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Oryctolagus cuniculus (Rabbit) CTLA4 (Cytotoxic T-lymphocyte associated protein 4, 36-223aa) for Antibody Discovery (CAT#: MP1514J)

This product is Oryctolagus cuniculus (Rabbit) CTLA4 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Oryctolagus cuniculus (Rabbit)
  • Target Protein
  • CTLA4
  • Protein Length
  • Partial (36-223aa)
  • Protein Class
  • Drug Target
  • TMD
  • 1
  • Sequence
  • KALHVSQPAVVLASSRGVASFVCEYASSHKATEVRVTVLRQANSQMTEVCAMTYTVENELTFIDDSTCTGISHGNKVNLTIQGLSAMDTGLYICKVELMYPPPYYVGMGNGTQIYVIEPEPCPDSDFLLWILAAISSGLFFYSFLITAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • N-His or Tag-Free
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • CTLA4
  • Full Name
  • Cytotoxic T-lymphocyte associated protein 4
  • Introduction
  • Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28.
  • Alternative Names
  • CTLA4; Cytotoxic T-lymphocyte protein 4; Cytotoxic T-lymphocyte-associated antigen 4; CTLA-4; CD antigen CD152

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us