Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ILDR2 (Immunoglobulin like domain containing receptor 2) Expressed in Yeast with 6xHis tag at the N-terminus for Antibody Discovery, Partial (1-186aa) (CAT#: MPX4415K)

This product is a 23.1kDa Human ILDR2 membrane protein expressed in Yeast. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ILDR2
  • Protein Length
  • Partial (1-186aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 23.1kDa
  • TMD
  • 1
  • Sequence
  • MDRVLLRWISLFWLTAMVEGLQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRGREITIVHDADLQIGKLMWGDSGLYYCIITTPDDLEGKNEDSVELLVLGRTGLLADLLPSFAVEIMPE

Product Description

  • Expression Systems
  • Yeast
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • ILDR2
  • Full Name
  • Immunoglobulin like domain containing receptor 2
  • Alternative Names
  • ILDR2; C1orf32; dJ782G3.1; immunoglobulin-like domain-containing receptor 2; angulin-3; Immunoglobulin like domain containing receptor 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us