Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human UBE2J1 (Ubiquitin conjugating enzyme E2 J1) Full Length (CAT#: MPC2182K) Made to Order

This product is a 35.1 kDa Human UBE2J1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • UBE2J1
  • Protein Length
  • Full length
  • Protein Class
  • Transferase
  • Molecular Weight
  • 35.1 kDa
  • TMD
  • 1
  • Sequence
  • METRYNLKSPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPD
    SDFDGGVYHGRIVLPPEYPMKPPSIILLTANGRFEVGKKICLSISGHHPE
    TWQPSWSIRTALLAIIGFMPTKGEGAIGSLDYTPEERRALAKKSQDFCCE
    GCGSAMKDVLLPLKSGSDSSQADQEAKELARQISFKAEVNSSGKTISESD
    LNHSFSLTDLQDDIPTTFQGATASTSYGLQNSSAASFHQPTQPVAKNTSM
    SPRQRRAQQQSQRRLSTSPDVIQGHQPRDNHTDHGGSAVLIVILTLALAA
    LIFRRIYLANEYIFDFEL

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • UBE2J1
  • Full Name
  • Ubiquitin conjugating enzyme E2 J1
  • Introduction
  • The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is located in the membrane of the endoplasmic reticulum (ER) and may contribute to quality control ER-associated degradation by the ubiquitin-proteasome system.
  • Alternative Names
  • UBE2J1; UBC6; UBC6E; Ubc6p; CGI-76; NCUBE1; HSPC153; HSPC205; NCUBE-1; HSU93243; ubiquitin-conjugating enzyme E2 J1; E2 ubiquitin-conjugating enzyme J1; HSUBC6e; non-canonical ubiquitin-conjugating enzyme 1; ubiquitin-conjugating enzyme E2, J1 (UBC6 homolog, yeast); ubiquitin-conjugating enzyme E2, J1, U; yeast ubiquitin-conjugating enzyme UBC6 homolog E; Ubiquitin conjugating enzyme E2 J1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us